# PaCkAgE DaTaStReAm TNFpkgsrc 1 29725 # end of header 0707015f0a388c000081a40000000000000000000000014ad9ca6d00000148000001220000021fffffffffffffffff0000001200000000TNFpkgsrc/pkginfoPKG=TNFpkgsrc NAME=The NetBSD Packages Collection, Solaris Bootstrap Kit DESC=Solaris binaries of pkg_* tools to install and manage Solaris packages created using pkgsrc VERSION=2009Q3 ARCH=i86pc CLASSES=none CATEGORY=system VENDOR=TNF EMAIL=pkgsrc-users@netbsd.org PSTAMP=20091017 ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 BASEDIR=/ 0707016e10f8a8000081a40000000000000000000000014ad9ca6d0000592f000001220000021fffffffffffffffff0000001100000000TNFpkgsrc/pkgmap: 1 29725 1 d none /etc 0755 root sys 1 d none /etc/opt 0755 root sys 1 d none /etc/opt/pkg 0755 root root 1 f none /etc/opt/pkg/mk.conf 0644 root root 499 38745 1255785774 1 d none /etc/opt/pkg/pkgin 0755 root root 1 f none /etc/opt/pkg/pkgin/repositories.conf 0644 root root 374 31308 1255785810 1 d none /opt 0755 root sys 1 d none /opt/pkg 0755 root root 1 d none /opt/pkg/bin 0755 root root 1 f none /opt/pkg/bin/bmake 0555 root root 207528 18777 1255785584 1 f none /opt/pkg/bin/install-sh 0555 root root 6619 4720 1255785501 1 f none /opt/pkg/bin/nawk 0555 root root 132204 13027 1255785590 1 f none /opt/pkg/bin/nbsed 0555 root root 41104 32268 1255785628 1 f none /opt/pkg/bin/pdksh 0555 root root 279948 12318 1255785522 1 f none /opt/pkg/bin/pkg_install-info 0555 root root 36928 13228 1255304314 1 f none /opt/pkg/bin/pkgin 0555 root root 650900 23281 1255784927 1 f none /opt/pkg/bin/sqlite3 0755 root root 55512 20462 1255309363 1 d none /opt/pkg/etc 0755 root root 1 d none /opt/pkg/etc/pkgin 0755 root root 1 d none /opt/pkg/include 0755 root root 1 f none /opt/pkg/include/archive.h 0444 root root 26396 48936 1255304428 1 f none /opt/pkg/include/archive_entry.h 0444 root root 21747 29633 1255304428 1 d none /opt/pkg/include/readline 0755 root root 1 f none /opt/pkg/include/readline/chardefs.h 0444 root root 4551 20202 1255309265 1 f none /opt/pkg/include/readline/history.h 0444 root root 10099 15082 1255309265 1 f none /opt/pkg/include/readline/keymaps.h 0444 root root 3397 25653 1255309265 1 f none /opt/pkg/include/readline/readline.h 0444 root root 35142 27262 1255309265 1 f none /opt/pkg/include/readline/rlconf.h 0444 root root 2189 52047 1255309265 1 f none /opt/pkg/include/readline/rlstdc.h 0444 root root 1546 61309 1255309265 1 f none /opt/pkg/include/readline/rltypedefs.h 0444 root root 2845 42023 1255309265 1 f none /opt/pkg/include/readline/tilde.h 0444 root root 3046 63660 1255309265 1 f none /opt/pkg/include/sqlite3.h 0644 root root 260204 52824 1255309363 1 f none /opt/pkg/include/sqlite3ext.h 0644 root root 20754 65416 1255309364 1 d none /opt/pkg/info 0755 root root 1 f none /opt/pkg/info/dir 0644 root root 741 62336 1255785810 1 f none /opt/pkg/info/history.info 0444 root root 58226 54308 1255309265 1 f none /opt/pkg/info/readline.info 0444 root root 197344 27088 1255309265 1 f none /opt/pkg/info/rluserman.info 0444 root root 73638 56525 1255309265 1 d none /opt/pkg/lib 0755 root root 1 f none /opt/pkg/lib/libarchive.a 0644 root root 415396 31523 1255304428 1 f none /opt/pkg/lib/libarchive.la 0755 root root 881 9894 1255304428 1 s none /opt/pkg/lib/libarchive.so=libarchive.so.2.5.5 1 s none /opt/pkg/lib/libarchive.so.2=libarchive.so.2.5.5 1 f none /opt/pkg/lib/libarchive.so.2.5.5 0755 root root 306080 63132 1255304428 1 f none /opt/pkg/lib/libhistory.a 0644 root root 53600 62012 1255309265 1 f none /opt/pkg/lib/libhistory.la 0755 root root 857 8225 1255309265 1 s none /opt/pkg/lib/libhistory.so=libhistory.so.6.0.0 1 s none /opt/pkg/lib/libhistory.so.6=libhistory.so.6.0.0 1 f none /opt/pkg/lib/libhistory.so.6.0.0 0755 root root 45120 56856 1255309265 1 f none /opt/pkg/lib/libreadline.a 0644 root root 395564 26891 1255309265 1 f none /opt/pkg/lib/libreadline.la 0755 root root 887 10655 1255309265 1 s none /opt/pkg/lib/libreadline.so=libreadline.so.6.0.0 1 s none /opt/pkg/lib/libreadline.so.6=libreadline.so.6.0.0 1 f none /opt/pkg/lib/libreadline.so.6.0.0 0755 root root 299184 21492 1255309265 1 f none /opt/pkg/lib/libsqlite3.a 0644 root root 817108 29925 1255309363 1 f none /opt/pkg/lib/libsqlite3.la 0755 root root 881 9740 1255309363 1 s none /opt/pkg/lib/libsqlite3.so=libsqlite3.so.0.8.6 1 s none /opt/pkg/lib/libsqlite3.so.0=libsqlite3.so.0.8.6 1 f none /opt/pkg/lib/libsqlite3.so.0.8.6 0755 root root 629624 40736 1255309363 1 d none /opt/pkg/lib/pkgconfig 0755 root root 1 f none /opt/pkg/lib/pkgconfig/sqlite3.pc 0644 root root 286 25599 1255309364 1 d none /opt/pkg/man 0755 root root 1 d none /opt/pkg/man/cat1 0755 root root 1 f none /opt/pkg/man/cat1/nbsed.0 0444 root root 14836 38387 1255785628 1 f none /opt/pkg/man/cat1/pkg_add.0 0444 root root 19032 39851 1255785722 1 f none /opt/pkg/man/cat1/pkg_admin.0 0444 root root 12015 32695 1255785722 1 f none /opt/pkg/man/cat1/pkg_create.0 0444 root root 16831 10069 1255785722 1 f none /opt/pkg/man/cat1/pkg_delete.0 0444 root root 10566 64827 1255785723 1 f none /opt/pkg/man/cat1/pkg_info.0 0444 root root 10408 7565 1255785723 1 d none /opt/pkg/man/cat5 0755 root root 1 f none /opt/pkg/man/cat5/pkg_install.conf.0 0444 root root 6452 2828 1255785722 1 f none /opt/pkg/man/cat5/pkg_summary.0 0444 root root 3687 14852 1255785722 1 d none /opt/pkg/man/cat7 0755 root root 1 f none /opt/pkg/man/cat7/pkgsrc.0 0444 root root 906 2679 1255785722 1 d none /opt/pkg/man/man1 0755 root root 1 f none /opt/pkg/man/man1/bmake.1 0444 root root 48075 40082 1255785584 1 f none /opt/pkg/man/man1/nawk.1 0444 root root 10710 59856 1255785590 1 f none /opt/pkg/man/man1/nbsed.1 0444 root root 14086 52576 1255785628 1 f none /opt/pkg/man/man1/pdksh.1 0444 root root 140372 12297 1255785522 1 f none /opt/pkg/man/man1/pkg_add.1 0444 root root 14826 54138 1255785722 1 f none /opt/pkg/man/man1/pkg_admin.1 0444 root root 11050 27919 1255785722 1 f none /opt/pkg/man/man1/pkg_create.1 0444 root root 13820 36874 1255785722 1 f none /opt/pkg/man/man1/pkg_delete.1 0444 root root 8343 9626 1255785723 1 f none /opt/pkg/man/man1/pkg_info.1 0444 root root 9041 2715 1255785723 1 f none /opt/pkg/man/man1/pkgin.1 0444 root root 5495 15094 1255784927 1 f none /opt/pkg/man/man1/sqlite3.1 0444 root root 6786 37437 1255309364 1 d none /opt/pkg/man/man3 0755 root root 1 f none /opt/pkg/man/man3/archive_entry.3 0444 root root 14567 53820 1255304428 1 f none /opt/pkg/man/man3/archive_read.3 0444 root root 18399 64604 1255304428 1 f none /opt/pkg/man/man3/archive_util.3 0444 root root 4729 7605 1255304428 1 f none /opt/pkg/man/man3/archive_write.3 0444 root root 17636 5941 1255304428 1 f none /opt/pkg/man/man3/archive_write_disk.3 0444 root root 12845 28893 1255304428 1 f none /opt/pkg/man/man3/history.3 0444 root root 21769 32860 1255309265 1 f none /opt/pkg/man/man3/libarchive.3 0444 root root 10574 26500 1255304428 1 f none /opt/pkg/man/man3/libarchive_internals.3 0444 root root 13760 49941 1255304428 1 f none /opt/pkg/man/man3/readline.3 0444 root root 39196 26853 1255309265 1 d none /opt/pkg/man/man5 0755 root root 1 f none /opt/pkg/man/man5/cpio.5 0444 root root 10766 61848 1255304428 1 f none /opt/pkg/man/man5/libarchive-formats.5 0444 root root 11092 25 1255304428 1 f none /opt/pkg/man/man5/mtree.5 0444 root root 7230 25771 1255304428 1 f none /opt/pkg/man/man5/pkg_install.conf.5 0444 root root 6220 3518 1255785722 1 f none /opt/pkg/man/man5/pkg_summary.5 0444 root root 4919 18565 1255785722 1 f none /opt/pkg/man/man5/tar.5 0444 root root 24538 8981 1255304428 1 d none /opt/pkg/man/man7 0755 root root 1 f none /opt/pkg/man/man7/pkgsrc.7 0444 root root 2190 43052 1255785722 1 d none /opt/pkg/sbin 0755 root root 1 f none /opt/pkg/sbin/audit-packages 0555 root root 2687 18168 1255785722 1 f none /opt/pkg/sbin/download-vulnerability-list 0555 root root 618 49488 1255785722 1 f none /opt/pkg/sbin/pkg_add 0755 root root 705640 25001 1255785722 1 f none /opt/pkg/sbin/pkg_admin 0755 root root 651560 27598 1255785722 1 f none /opt/pkg/sbin/pkg_create 0755 root root 416428 33734 1255785722 1 f none /opt/pkg/sbin/pkg_delete 0755 root root 306200 62979 1255785723 1 f none /opt/pkg/sbin/pkg_info 0755 root root 620920 37512 1255785723 1 d none /opt/pkg/share 0755 root root 1 d none /opt/pkg/share/examples 0755 root root 1 d none /opt/pkg/share/examples/pkgin 0755 root root 1 f none /opt/pkg/share/examples/pkgin/repositories.conf.example 0444 root root 374 31308 1255784927 1 d none /opt/pkg/share/mk 0755 root root 1 f none /opt/pkg/share/mk/bsd.README 0444 root root 24788 47754 1255785497 1 f none /opt/pkg/share/mk/bsd.dep.mk 0444 root root 622 50439 1255785497 1 f none /opt/pkg/share/mk/bsd.depall.mk 0444 root root 131 9388 1255785497 1 f none /opt/pkg/share/mk/bsd.doc.mk 0444 root root 1666 63868 1255785497 1 f none /opt/pkg/share/mk/bsd.files.mk 0444 root root 1287 33993 1255785497 1 f none /opt/pkg/share/mk/bsd.hostprog.mk 0444 root root 3193 49111 1255785497 1 f none /opt/pkg/share/mk/bsd.inc.mk 0444 root root 766 56548 1255785497 1 f none /opt/pkg/share/mk/bsd.info.mk 0444 root root 1866 15506 1255785497 1 f none /opt/pkg/share/mk/bsd.kernobj.mk 0444 root root 1265 34714 1255785497 1 f none /opt/pkg/share/mk/bsd.kinc.mk 0444 root root 3700 21856 1255785497 1 f none /opt/pkg/share/mk/bsd.kmod.mk 0444 root root 2133 34709 1255785497 1 f none /opt/pkg/share/mk/bsd.lib.mk 0444 root root 14785 9149 1255785497 1 f none /opt/pkg/share/mk/bsd.links.mk 0444 root root 904 62748 1255785498 1 f none /opt/pkg/share/mk/bsd.man.mk 0444 root root 5501 22061 1255785498 1 f none /opt/pkg/share/mk/bsd.nls.mk 0444 root root 1537 51232 1255785498 1 f none /opt/pkg/share/mk/bsd.obj.mk 0444 root root 2027 24846 1255785498 1 f none /opt/pkg/share/mk/bsd.own.mk 0444 root root 7213 45519 1255785498 1 f none /opt/pkg/share/mk/bsd.prog.mk 0444 root root 4569 24604 1255785498 1 f none /opt/pkg/share/mk/bsd.subdir.mk 0444 root root 1452 43764 1255785498 1 f none /opt/pkg/share/mk/bsd.sys.mk 0444 root root 3291 51583 1255785498 1 f none /opt/pkg/share/mk/sys.mk 0444 root root 3822 4586 1255785498 1 d none /var 0755 root sys 1 d none /var/opt 0755 root sys 1 d none /var/opt/pkg 0755 root root 1 d none /var/opt/pkg/db 0755 root root 1 d none /var/opt/pkg/db/pkg 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/+PREEXISTING 0644 root root 12 835 1255785810 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 d none /var/opt/pkg/db/pkg.refcount/files 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf/+PERMISSIONS 0644 root root 7 280 1255785810 1 f none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 d none /var/opt/pkg/db/pkg/bmake-20090909 0755 root root 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+BUILD_INFO 0644 root root 1999 32718 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+BUILD_VERSION 0644 root root 3198 39692 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+COMMENT 0644 root root 53 4750 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+CONTENTS 0644 root root 330 25738 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+DESC 0644 root root 246 22581 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+PRESERVE 0644 root root 29 1727 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+SIZE_ALL 0644 root root 7 322 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+SIZE_PKG 0644 root root 7 319 1255785584 1 d none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807 0755 root root 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+BUILD_INFO 0644 root root 1835 20414 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+BUILD_VERSION 0644 root root 2355 53679 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+COMMENT 0644 root root 43 3975 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+CONTENTS 0644 root root 1539 54152 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+DESC 0644 root root 249 22643 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+PRESERVE 0644 root root 29 1727 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+REQUIRED_BY 0644 root root 15 980 1255785584 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+SIZE_ALL 0644 root root 6 278 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+SIZE_PKG 0644 root root 6 278 1255785498 1 d none /var/opt/pkg/db/pkg/install-sh-20070712 0755 root root 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+BUILD_INFO 0644 root root 1731 10735 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+BUILD_VERSION 0644 root root 270 20611 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+COMMENT 0644 root root 55 5211 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+CONTENTS 0644 root root 166 12342 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+DESC 0644 root root 95 8711 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+PRESERVE 0644 root root 29 1721 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+SIZE_ALL 0644 root root 5 224 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+SIZE_PKG 0644 root root 5 224 1255785501 1 d none /var/opt/pkg/db/pkg/libarchive-2.5.5 0755 root root 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+BUILD_INFO 0444 root root 2876 42818 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+BUILD_VERSION 0444 root root 357 27489 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+COMMENT 0444 root root 49 4662 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+CONTENTS 0644 root root 1470 51187 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+DESC 0444 root root 290 26749 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+REQUIRED_BY 0644 root root 12 835 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+SIZE_ALL 0444 root root 7 331 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+SIZE_PKG 0444 root root 7 331 1255785810 1 d none /var/opt/pkg/db/pkg/nawk-20050424nb3 0755 root root 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+BUILD_INFO 0644 root root 1732 7852 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+BUILD_VERSION 0644 root root 1726 59193 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+COMMENT 0644 root root 68 6491 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+CONTENTS 0644 root root 217 16004 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+DESC 0644 root root 391 33811 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+PRESERVE 0644 root root 29 1724 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+SIZE_ALL 0644 root root 7 319 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+SIZE_PKG 0644 root root 7 319 1255785590 1 d none /var/opt/pkg/db/pkg/nbsed-20040821nb1 0755 root root 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+BUILD_INFO 0644 root root 2958 52050 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+BUILD_VERSION 0644 root root 927 4117 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+COMMENT 0644 root root 24 1970 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+CONTENTS 0644 root root 281 20988 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+DESC 0644 root root 283 25458 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+PRESERVE 0644 root root 29 1721 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+SIZE_ALL 0644 root root 6 265 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+SIZE_PKG 0644 root root 6 265 1255785628 1 d none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4 0755 root root 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+BUILD_INFO 0644 root root 2648 22925 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+BUILD_VERSION 0644 root root 4218 52224 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+COMMENT 0644 root root 34 2868 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+CONTENTS 0644 root root 216 15936 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+DEINSTALL 0755 root root 4192 46188 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+DESC 0644 root root 365 33087 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+INSTALL 0755 root root 10180 24320 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+PRESERVE 0644 root root 29 1724 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+REQUIRED_BY 0644 root root 15 980 1255785584 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SHELL 0755 root root 4979 37817 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SIZE_ALL 0644 root root 7 309 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SIZE_PKG 0644 root root 7 309 1255785522 1 d none /var/opt/pkg/db/pkg/pkg_install-20091008 0755 root root 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+BUILD_INFO 0644 root root 4047 18639 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+BUILD_VERSION 0644 root root 528 39641 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+COMMENT 0644 root root 55 5294 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+CONTENTS 0644 root root 1665 63226 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DEINSTALL 0755 root root 31 2636 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DESC 0644 root root 824 12965 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DISPLAY 0644 root root 1476 60627 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+INSTALL 0755 root root 334 23900 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+PRESERVE 0644 root root 29 1716 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+SIZE_ALL 0644 root root 8 382 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+SIZE_PKG 0644 root root 8 382 1255785723 1 d none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3 0755 root root 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+BUILD_INFO 0444 root root 2667 26091 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+BUILD_VERSION 0444 root root 577 44639 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+COMMENT 0444 root root 46 4367 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+CONTENTS 0644 root root 306 23430 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+DESC 0444 root root 291 27051 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+REQUIRED_BY 0644 root root 13 1039 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+SIZE_ALL 0444 root root 6 278 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+SIZE_PKG 0444 root root 6 278 1255785810 1 f none /var/opt/pkg/db/pkg/pkgdb.byfile.db 0644 root root 20480 1056 1255785810 1 d none /var/opt/pkg/db/pkg/pkgin-0.2.5 0755 root root 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+BUILD_INFO 0444 root root 2866 38742 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+BUILD_VERSION 0444 root root 623 48879 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+COMMENT 0444 root root 56 5139 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+CONTENTS 0644 root root 733 57463 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DEINSTALL 0555 root root 4172 43986 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DESC 0444 root root 252 23086 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DIRS 0755 root root 9182 26636 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DISPLAY 0444 root root 358 25873 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+FILES 0755 root root 11171 35738 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+INSTALL 0555 root root 25913 9778 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+SIZE_ALL 0444 root root 8 377 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+SIZE_PKG 0444 root root 7 337 1255785810 1 d none /var/opt/pkg/db/pkg/readline-6.0 0755 root root 1 f none /var/opt/pkg/db/pkg/readline-6.0/+BUILD_INFO 0444 root root 2959 49627 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+BUILD_VERSION 0444 root root 670 50177 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+COMMENT 0444 root root 52 4805 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+CONTENTS 0644 root root 1961 27119 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+DEINSTALL 0555 root root 4175 44285 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+DESC 0444 root root 216 20026 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INFO_FILES 0755 root root 2937 31019 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INSTALL 0555 root root 8157 18456 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+REQUIRED_BY 0644 root root 15 1065 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+SIZE_ALL 0444 root root 8 370 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+SIZE_PKG 0444 root root 8 378 1255785810 1 d none /var/opt/pkg/db/pkg/sqlite3-3.6.17 0755 root root 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+BUILD_INFO 0444 root root 3287 10471 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+BUILD_VERSION 0444 root root 560 42880 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+COMMENT 0444 root root 35 2933 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+CONTENTS 0644 root root 1026 14655 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+DESC 0444 root root 584 52957 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+REQUIRED_BY 0644 root root 12 835 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+SIZE_ALL 0444 root root 8 373 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+SIZE_PKG 0444 root root 8 377 1255785810 1 d none /var/opt/pkg/db/pkgin 0755 root root 1 d none /var/opt/pkg/db/pkgin/cache 0755 root root 1 f none /var/opt/pkg/db/pkgin/pkgin.db 0644 root root 47104 65039 1255785844 1 f none /var/opt/pkg/db/pkgin/pkgin.db-journal 0644 root root 14960 7641 1255785844 1 f none /var/opt/pkg/db/pkgin/pkgin.log 0644 root root 0 0 1255785960 1 i pkginfo 328 26791 1255787117 1 i postinstall 618 51094 1255786996 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707015f0a388c000081a40000000000000000000000014ad9ca6d00000148000001220000021fffffffffffffffff0000000800000000pkginfoPKG=TNFpkgsrc NAME=The NetBSD Packages Collection, Solaris Bootstrap Kit DESC=Solaris binaries of pkg_* tools to install and manage Solaris packages created using pkgsrc VERSION=2009Q3 ARCH=i86pc CLASSES=none CATEGORY=system VENDOR=TNF EMAIL=pkgsrc-users@netbsd.org PSTAMP=20091017 ISTATES=S s 1 2 3 RSTATES=S s 1 2 3 BASEDIR=/ 0707016e10f8a8000081a40000000000000000000000014ad9ca6d0000592f000001220000021fffffffffffffffff0000000700000000pkgmap: 1 29725 1 d none /etc 0755 root sys 1 d none /etc/opt 0755 root sys 1 d none /etc/opt/pkg 0755 root root 1 f none /etc/opt/pkg/mk.conf 0644 root root 499 38745 1255785774 1 d none /etc/opt/pkg/pkgin 0755 root root 1 f none /etc/opt/pkg/pkgin/repositories.conf 0644 root root 374 31308 1255785810 1 d none /opt 0755 root sys 1 d none /opt/pkg 0755 root root 1 d none /opt/pkg/bin 0755 root root 1 f none /opt/pkg/bin/bmake 0555 root root 207528 18777 1255785584 1 f none /opt/pkg/bin/install-sh 0555 root root 6619 4720 1255785501 1 f none /opt/pkg/bin/nawk 0555 root root 132204 13027 1255785590 1 f none /opt/pkg/bin/nbsed 0555 root root 41104 32268 1255785628 1 f none /opt/pkg/bin/pdksh 0555 root root 279948 12318 1255785522 1 f none /opt/pkg/bin/pkg_install-info 0555 root root 36928 13228 1255304314 1 f none /opt/pkg/bin/pkgin 0555 root root 650900 23281 1255784927 1 f none /opt/pkg/bin/sqlite3 0755 root root 55512 20462 1255309363 1 d none /opt/pkg/etc 0755 root root 1 d none /opt/pkg/etc/pkgin 0755 root root 1 d none /opt/pkg/include 0755 root root 1 f none /opt/pkg/include/archive.h 0444 root root 26396 48936 1255304428 1 f none /opt/pkg/include/archive_entry.h 0444 root root 21747 29633 1255304428 1 d none /opt/pkg/include/readline 0755 root root 1 f none /opt/pkg/include/readline/chardefs.h 0444 root root 4551 20202 1255309265 1 f none /opt/pkg/include/readline/history.h 0444 root root 10099 15082 1255309265 1 f none /opt/pkg/include/readline/keymaps.h 0444 root root 3397 25653 1255309265 1 f none /opt/pkg/include/readline/readline.h 0444 root root 35142 27262 1255309265 1 f none /opt/pkg/include/readline/rlconf.h 0444 root root 2189 52047 1255309265 1 f none /opt/pkg/include/readline/rlstdc.h 0444 root root 1546 61309 1255309265 1 f none /opt/pkg/include/readline/rltypedefs.h 0444 root root 2845 42023 1255309265 1 f none /opt/pkg/include/readline/tilde.h 0444 root root 3046 63660 1255309265 1 f none /opt/pkg/include/sqlite3.h 0644 root root 260204 52824 1255309363 1 f none /opt/pkg/include/sqlite3ext.h 0644 root root 20754 65416 1255309364 1 d none /opt/pkg/info 0755 root root 1 f none /opt/pkg/info/dir 0644 root root 741 62336 1255785810 1 f none /opt/pkg/info/history.info 0444 root root 58226 54308 1255309265 1 f none /opt/pkg/info/readline.info 0444 root root 197344 27088 1255309265 1 f none /opt/pkg/info/rluserman.info 0444 root root 73638 56525 1255309265 1 d none /opt/pkg/lib 0755 root root 1 f none /opt/pkg/lib/libarchive.a 0644 root root 415396 31523 1255304428 1 f none /opt/pkg/lib/libarchive.la 0755 root root 881 9894 1255304428 1 s none /opt/pkg/lib/libarchive.so=libarchive.so.2.5.5 1 s none /opt/pkg/lib/libarchive.so.2=libarchive.so.2.5.5 1 f none /opt/pkg/lib/libarchive.so.2.5.5 0755 root root 306080 63132 1255304428 1 f none /opt/pkg/lib/libhistory.a 0644 root root 53600 62012 1255309265 1 f none /opt/pkg/lib/libhistory.la 0755 root root 857 8225 1255309265 1 s none /opt/pkg/lib/libhistory.so=libhistory.so.6.0.0 1 s none /opt/pkg/lib/libhistory.so.6=libhistory.so.6.0.0 1 f none /opt/pkg/lib/libhistory.so.6.0.0 0755 root root 45120 56856 1255309265 1 f none /opt/pkg/lib/libreadline.a 0644 root root 395564 26891 1255309265 1 f none /opt/pkg/lib/libreadline.la 0755 root root 887 10655 1255309265 1 s none /opt/pkg/lib/libreadline.so=libreadline.so.6.0.0 1 s none /opt/pkg/lib/libreadline.so.6=libreadline.so.6.0.0 1 f none /opt/pkg/lib/libreadline.so.6.0.0 0755 root root 299184 21492 1255309265 1 f none /opt/pkg/lib/libsqlite3.a 0644 root root 817108 29925 1255309363 1 f none /opt/pkg/lib/libsqlite3.la 0755 root root 881 9740 1255309363 1 s none /opt/pkg/lib/libsqlite3.so=libsqlite3.so.0.8.6 1 s none /opt/pkg/lib/libsqlite3.so.0=libsqlite3.so.0.8.6 1 f none /opt/pkg/lib/libsqlite3.so.0.8.6 0755 root root 629624 40736 1255309363 1 d none /opt/pkg/lib/pkgconfig 0755 root root 1 f none /opt/pkg/lib/pkgconfig/sqlite3.pc 0644 root root 286 25599 1255309364 1 d none /opt/pkg/man 0755 root root 1 d none /opt/pkg/man/cat1 0755 root root 1 f none /opt/pkg/man/cat1/nbsed.0 0444 root root 14836 38387 1255785628 1 f none /opt/pkg/man/cat1/pkg_add.0 0444 root root 19032 39851 1255785722 1 f none /opt/pkg/man/cat1/pkg_admin.0 0444 root root 12015 32695 1255785722 1 f none /opt/pkg/man/cat1/pkg_create.0 0444 root root 16831 10069 1255785722 1 f none /opt/pkg/man/cat1/pkg_delete.0 0444 root root 10566 64827 1255785723 1 f none /opt/pkg/man/cat1/pkg_info.0 0444 root root 10408 7565 1255785723 1 d none /opt/pkg/man/cat5 0755 root root 1 f none /opt/pkg/man/cat5/pkg_install.conf.0 0444 root root 6452 2828 1255785722 1 f none /opt/pkg/man/cat5/pkg_summary.0 0444 root root 3687 14852 1255785722 1 d none /opt/pkg/man/cat7 0755 root root 1 f none /opt/pkg/man/cat7/pkgsrc.0 0444 root root 906 2679 1255785722 1 d none /opt/pkg/man/man1 0755 root root 1 f none /opt/pkg/man/man1/bmake.1 0444 root root 48075 40082 1255785584 1 f none /opt/pkg/man/man1/nawk.1 0444 root root 10710 59856 1255785590 1 f none /opt/pkg/man/man1/nbsed.1 0444 root root 14086 52576 1255785628 1 f none /opt/pkg/man/man1/pdksh.1 0444 root root 140372 12297 1255785522 1 f none /opt/pkg/man/man1/pkg_add.1 0444 root root 14826 54138 1255785722 1 f none /opt/pkg/man/man1/pkg_admin.1 0444 root root 11050 27919 1255785722 1 f none /opt/pkg/man/man1/pkg_create.1 0444 root root 13820 36874 1255785722 1 f none /opt/pkg/man/man1/pkg_delete.1 0444 root root 8343 9626 1255785723 1 f none /opt/pkg/man/man1/pkg_info.1 0444 root root 9041 2715 1255785723 1 f none /opt/pkg/man/man1/pkgin.1 0444 root root 5495 15094 1255784927 1 f none /opt/pkg/man/man1/sqlite3.1 0444 root root 6786 37437 1255309364 1 d none /opt/pkg/man/man3 0755 root root 1 f none /opt/pkg/man/man3/archive_entry.3 0444 root root 14567 53820 1255304428 1 f none /opt/pkg/man/man3/archive_read.3 0444 root root 18399 64604 1255304428 1 f none /opt/pkg/man/man3/archive_util.3 0444 root root 4729 7605 1255304428 1 f none /opt/pkg/man/man3/archive_write.3 0444 root root 17636 5941 1255304428 1 f none /opt/pkg/man/man3/archive_write_disk.3 0444 root root 12845 28893 1255304428 1 f none /opt/pkg/man/man3/history.3 0444 root root 21769 32860 1255309265 1 f none /opt/pkg/man/man3/libarchive.3 0444 root root 10574 26500 1255304428 1 f none /opt/pkg/man/man3/libarchive_internals.3 0444 root root 13760 49941 1255304428 1 f none /opt/pkg/man/man3/readline.3 0444 root root 39196 26853 1255309265 1 d none /opt/pkg/man/man5 0755 root root 1 f none /opt/pkg/man/man5/cpio.5 0444 root root 10766 61848 1255304428 1 f none /opt/pkg/man/man5/libarchive-formats.5 0444 root root 11092 25 1255304428 1 f none /opt/pkg/man/man5/mtree.5 0444 root root 7230 25771 1255304428 1 f none /opt/pkg/man/man5/pkg_install.conf.5 0444 root root 6220 3518 1255785722 1 f none /opt/pkg/man/man5/pkg_summary.5 0444 root root 4919 18565 1255785722 1 f none /opt/pkg/man/man5/tar.5 0444 root root 24538 8981 1255304428 1 d none /opt/pkg/man/man7 0755 root root 1 f none /opt/pkg/man/man7/pkgsrc.7 0444 root root 2190 43052 1255785722 1 d none /opt/pkg/sbin 0755 root root 1 f none /opt/pkg/sbin/audit-packages 0555 root root 2687 18168 1255785722 1 f none /opt/pkg/sbin/download-vulnerability-list 0555 root root 618 49488 1255785722 1 f none /opt/pkg/sbin/pkg_add 0755 root root 705640 25001 1255785722 1 f none /opt/pkg/sbin/pkg_admin 0755 root root 651560 27598 1255785722 1 f none /opt/pkg/sbin/pkg_create 0755 root root 416428 33734 1255785722 1 f none /opt/pkg/sbin/pkg_delete 0755 root root 306200 62979 1255785723 1 f none /opt/pkg/sbin/pkg_info 0755 root root 620920 37512 1255785723 1 d none /opt/pkg/share 0755 root root 1 d none /opt/pkg/share/examples 0755 root root 1 d none /opt/pkg/share/examples/pkgin 0755 root root 1 f none /opt/pkg/share/examples/pkgin/repositories.conf.example 0444 root root 374 31308 1255784927 1 d none /opt/pkg/share/mk 0755 root root 1 f none /opt/pkg/share/mk/bsd.README 0444 root root 24788 47754 1255785497 1 f none /opt/pkg/share/mk/bsd.dep.mk 0444 root root 622 50439 1255785497 1 f none /opt/pkg/share/mk/bsd.depall.mk 0444 root root 131 9388 1255785497 1 f none /opt/pkg/share/mk/bsd.doc.mk 0444 root root 1666 63868 1255785497 1 f none /opt/pkg/share/mk/bsd.files.mk 0444 root root 1287 33993 1255785497 1 f none /opt/pkg/share/mk/bsd.hostprog.mk 0444 root root 3193 49111 1255785497 1 f none /opt/pkg/share/mk/bsd.inc.mk 0444 root root 766 56548 1255785497 1 f none /opt/pkg/share/mk/bsd.info.mk 0444 root root 1866 15506 1255785497 1 f none /opt/pkg/share/mk/bsd.kernobj.mk 0444 root root 1265 34714 1255785497 1 f none /opt/pkg/share/mk/bsd.kinc.mk 0444 root root 3700 21856 1255785497 1 f none /opt/pkg/share/mk/bsd.kmod.mk 0444 root root 2133 34709 1255785497 1 f none /opt/pkg/share/mk/bsd.lib.mk 0444 root root 14785 9149 1255785497 1 f none /opt/pkg/share/mk/bsd.links.mk 0444 root root 904 62748 1255785498 1 f none /opt/pkg/share/mk/bsd.man.mk 0444 root root 5501 22061 1255785498 1 f none /opt/pkg/share/mk/bsd.nls.mk 0444 root root 1537 51232 1255785498 1 f none /opt/pkg/share/mk/bsd.obj.mk 0444 root root 2027 24846 1255785498 1 f none /opt/pkg/share/mk/bsd.own.mk 0444 root root 7213 45519 1255785498 1 f none /opt/pkg/share/mk/bsd.prog.mk 0444 root root 4569 24604 1255785498 1 f none /opt/pkg/share/mk/bsd.subdir.mk 0444 root root 1452 43764 1255785498 1 f none /opt/pkg/share/mk/bsd.sys.mk 0444 root root 3291 51583 1255785498 1 f none /opt/pkg/share/mk/sys.mk 0444 root root 3822 4586 1255785498 1 d none /var 0755 root sys 1 d none /var/opt 0755 root sys 1 d none /var/opt/pkg 0755 root root 1 d none /var/opt/pkg/db 0755 root root 1 d none /var/opt/pkg/db/pkg 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/+PREEXISTING 0644 root root 12 835 1255785810 1 d none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 f none /var/opt/pkg/db/pkg.refcount/dirs/etc/opt/pkg/pkgin/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 d none /var/opt/pkg/db/pkg.refcount/files 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin 0755 root root 1 d none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf 0755 root root 1 f none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf/+PERMISSIONS 0644 root root 7 280 1255785810 1 f none /var/opt/pkg/db/pkg.refcount/files/etc/opt/pkg/pkgin/repositories.conf/pkgin-0.2.5 0644 root root 32 2627 1255785810 1 d none /var/opt/pkg/db/pkg/bmake-20090909 0755 root root 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+BUILD_INFO 0644 root root 1999 32718 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+BUILD_VERSION 0644 root root 3198 39692 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+COMMENT 0644 root root 53 4750 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+CONTENTS 0644 root root 330 25738 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+DESC 0644 root root 246 22581 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+PRESERVE 0644 root root 29 1727 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+SIZE_ALL 0644 root root 7 322 1255785584 1 f none /var/opt/pkg/db/pkg/bmake-20090909/+SIZE_PKG 0644 root root 7 319 1255785584 1 d none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807 0755 root root 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+BUILD_INFO 0644 root root 1835 20414 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+BUILD_VERSION 0644 root root 2355 53679 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+COMMENT 0644 root root 43 3975 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+CONTENTS 0644 root root 1539 54152 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+DESC 0644 root root 249 22643 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+PRESERVE 0644 root root 29 1727 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+REQUIRED_BY 0644 root root 15 980 1255785584 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+SIZE_ALL 0644 root root 6 278 1255785498 1 f none /var/opt/pkg/db/pkg/bootstrap-mk-files-20090807/+SIZE_PKG 0644 root root 6 278 1255785498 1 d none /var/opt/pkg/db/pkg/install-sh-20070712 0755 root root 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+BUILD_INFO 0644 root root 1731 10735 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+BUILD_VERSION 0644 root root 270 20611 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+COMMENT 0644 root root 55 5211 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+CONTENTS 0644 root root 166 12342 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+DESC 0644 root root 95 8711 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+PRESERVE 0644 root root 29 1721 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+SIZE_ALL 0644 root root 5 224 1255785501 1 f none /var/opt/pkg/db/pkg/install-sh-20070712/+SIZE_PKG 0644 root root 5 224 1255785501 1 d none /var/opt/pkg/db/pkg/libarchive-2.5.5 0755 root root 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+BUILD_INFO 0444 root root 2876 42818 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+BUILD_VERSION 0444 root root 357 27489 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+COMMENT 0444 root root 49 4662 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+CONTENTS 0644 root root 1470 51187 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+DESC 0444 root root 290 26749 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+REQUIRED_BY 0644 root root 12 835 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+SIZE_ALL 0444 root root 7 331 1255785810 1 f none /var/opt/pkg/db/pkg/libarchive-2.5.5/+SIZE_PKG 0444 root root 7 331 1255785810 1 d none /var/opt/pkg/db/pkg/nawk-20050424nb3 0755 root root 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+BUILD_INFO 0644 root root 1732 7852 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+BUILD_VERSION 0644 root root 1726 59193 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+COMMENT 0644 root root 68 6491 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+CONTENTS 0644 root root 217 16004 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+DESC 0644 root root 391 33811 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+PRESERVE 0644 root root 29 1724 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+SIZE_ALL 0644 root root 7 319 1255785590 1 f none /var/opt/pkg/db/pkg/nawk-20050424nb3/+SIZE_PKG 0644 root root 7 319 1255785590 1 d none /var/opt/pkg/db/pkg/nbsed-20040821nb1 0755 root root 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+BUILD_INFO 0644 root root 2958 52050 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+BUILD_VERSION 0644 root root 927 4117 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+COMMENT 0644 root root 24 1970 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+CONTENTS 0644 root root 281 20988 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+DESC 0644 root root 283 25458 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+PRESERVE 0644 root root 29 1721 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+SIZE_ALL 0644 root root 6 265 1255785628 1 f none /var/opt/pkg/db/pkg/nbsed-20040821nb1/+SIZE_PKG 0644 root root 6 265 1255785628 1 d none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4 0755 root root 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+BUILD_INFO 0644 root root 2648 22925 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+BUILD_VERSION 0644 root root 4218 52224 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+COMMENT 0644 root root 34 2868 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+CONTENTS 0644 root root 216 15936 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+DEINSTALL 0755 root root 4192 46188 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+DESC 0644 root root 365 33087 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+INSTALL 0755 root root 10180 24320 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+PRESERVE 0644 root root 29 1724 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+REQUIRED_BY 0644 root root 15 980 1255785584 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SHELL 0755 root root 4979 37817 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SIZE_ALL 0644 root root 7 309 1255785522 1 f none /var/opt/pkg/db/pkg/pdksh-5.2.14nb4/+SIZE_PKG 0644 root root 7 309 1255785522 1 d none /var/opt/pkg/db/pkg/pkg_install-20091008 0755 root root 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+BUILD_INFO 0644 root root 4047 18639 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+BUILD_VERSION 0644 root root 528 39641 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+COMMENT 0644 root root 55 5294 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+CONTENTS 0644 root root 1665 63226 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DEINSTALL 0755 root root 31 2636 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DESC 0644 root root 824 12965 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+DISPLAY 0644 root root 1476 60627 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+INSTALL 0755 root root 334 23900 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+PRESERVE 0644 root root 29 1716 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+SIZE_ALL 0644 root root 8 382 1255785723 1 f none /var/opt/pkg/db/pkg/pkg_install-20091008/+SIZE_PKG 0644 root root 8 382 1255785723 1 d none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3 0755 root root 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+BUILD_INFO 0444 root root 2667 26091 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+BUILD_VERSION 0444 root root 577 44639 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+COMMENT 0444 root root 46 4367 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+CONTENTS 0644 root root 306 23430 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+DESC 0444 root root 291 27051 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+REQUIRED_BY 0644 root root 13 1039 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+SIZE_ALL 0444 root root 6 278 1255785810 1 f none /var/opt/pkg/db/pkg/pkg_install-info-4.5nb3/+SIZE_PKG 0444 root root 6 278 1255785810 1 f none /var/opt/pkg/db/pkg/pkgdb.byfile.db 0644 root root 20480 1056 1255785810 1 d none /var/opt/pkg/db/pkg/pkgin-0.2.5 0755 root root 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+BUILD_INFO 0444 root root 2866 38742 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+BUILD_VERSION 0444 root root 623 48879 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+COMMENT 0444 root root 56 5139 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+CONTENTS 0644 root root 733 57463 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DEINSTALL 0555 root root 4172 43986 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DESC 0444 root root 252 23086 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DIRS 0755 root root 9182 26636 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+DISPLAY 0444 root root 358 25873 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+FILES 0755 root root 11171 35738 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+INSTALL 0555 root root 25913 9778 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+SIZE_ALL 0444 root root 8 377 1255785810 1 f none /var/opt/pkg/db/pkg/pkgin-0.2.5/+SIZE_PKG 0444 root root 7 337 1255785810 1 d none /var/opt/pkg/db/pkg/readline-6.0 0755 root root 1 f none /var/opt/pkg/db/pkg/readline-6.0/+BUILD_INFO 0444 root root 2959 49627 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+BUILD_VERSION 0444 root root 670 50177 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+COMMENT 0444 root root 52 4805 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+CONTENTS 0644 root root 1961 27119 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+DEINSTALL 0555 root root 4175 44285 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+DESC 0444 root root 216 20026 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INFO_FILES 0755 root root 2937 31019 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INSTALL 0555 root root 8157 18456 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+REQUIRED_BY 0644 root root 15 1065 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+SIZE_ALL 0444 root root 8 370 1255785810 1 f none /var/opt/pkg/db/pkg/readline-6.0/+SIZE_PKG 0444 root root 8 378 1255785810 1 d none /var/opt/pkg/db/pkg/sqlite3-3.6.17 0755 root root 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+BUILD_INFO 0444 root root 3287 10471 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+BUILD_VERSION 0444 root root 560 42880 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+COMMENT 0444 root root 35 2933 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+CONTENTS 0644 root root 1026 14655 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+DESC 0444 root root 584 52957 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+INSTALLED_INFO 0644 root root 14 1375 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+REQUIRED_BY 0644 root root 12 835 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+SIZE_ALL 0444 root root 8 373 1255785810 1 f none /var/opt/pkg/db/pkg/sqlite3-3.6.17/+SIZE_PKG 0444 root root 8 377 1255785810 1 d none /var/opt/pkg/db/pkgin 0755 root root 1 d none /var/opt/pkg/db/pkgin/cache 0755 root root 1 f none /var/opt/pkg/db/pkgin/pkgin.db 0644 root root 47104 65039 1255785844 1 f none /var/opt/pkg/db/pkgin/pkgin.db-journal 0644 root root 14960 7641 1255785844 1 f none /var/opt/pkg/db/pkgin/pkgin.log 0644 root root 0 0 1255785960 1 i pkginfo 328 26791 1255787117 1 i postinstall 618 51094 1255786996 070701591224fd000041ed0000000000000000000000024ad9ca6d00000000000001220000021fffffffffffffffff0000000800000000install070701f729c8c5000081a40000000000000000000000014ad9c9f40000026a000001220000021fffffffffffffffff0000001400000000install/postinstall#!/bin/sh # echo "To get started with binary pkgsrc packages:" echo "" echo " # pkgsrc utilities need to be first in \$PATH" echo " $ PATH=/opt/pkg/sbin:/opt/pkg/bin:\$PATH" echo "" echo " # Update and initialise the remote package database" echo " $ pkgin up" echo "" echo " # List available packages" echo " $ pkgin avail" echo "" echo " # Search for a package using regular expressions" echo " $ pkgin search ^ap.*python" echo "" echo " # Install package and all dependancies" echo " $ pkgin install ap22-py25-python" echo "" echo " # Upgrade all packages to latest versions" echo " $ pkgin full-upgrade" echo "" 0707015b724b35000041ed0000000000000000000000054ad9ca6d00000000000001220000021fffffffffffffffff0000000500000000root07070159fdf2fc000041ed0000000000000000000000034ad9ca6d00000000000001220000021fffffffffffffffff0000000900000000root/etc0707016d219601000041ed0000000000000000000000034ad9ca6d00000000000001220000021fffffffffffffffff0000000d00000000root/etc/opt0707015edaa08d000041ed0000000000000000000000034ad9ca6d00000000000001220000021fffffffffffffffff0000001100000000root/etc/opt/pkg0707017000a438000081a40000000000000000000000014ad9c52e000001f3000001220000021fffffffffffffffff0000001900000000root/etc/opt/pkg/mk.conf.ifdef BSD_PKG_MK # begin pkgsrc settings PKGSRC_COMPILER= sunpro CC= cc CXX= CC CPP= ${CC} -E PKG_DBDIR= /var/opt/pkg/db/pkg LOCALBASE= /opt/pkg VARBASE= /var/opt/pkg PKG_SYSCONFBASE= /etc/opt/pkg PKG_TOOLS_BIN= /opt/pkg/sbin PKGMANDIR= man TOOLS_PLATFORM.install?= /opt/pkg/bin/install-sh TOOLS_PLATFORM.sh?= /opt/pkg/bin/pdksh TOOLS_PLATFORM.ksh?= /opt/pkg/bin/pdksh TOOLS_PLATFORM.awk?= /opt/pkg/bin/nawk TOOLS_PLATFORM.sed?= /opt/pkg/bin/nbsed .endif # end pkgsrc settings 0707015a841ac4000041ed0000000000000000000000024ad9ca6d00000000000001220000021fffffffffffffffff0000001700000000root/etc/opt/pkg/pkgin0707015ba01b88000081a40000000000000000000000014ad9c55200000176000001220000021fffffffffffffffff0000002900000000root/etc/opt/pkg/pkgin/repositories.conf# $Id: repositories.conf,v 1.1 2009/06/05 19:43:22 imil Exp $ # # Pkgin repositories list # # Simply add repositories one below the other # # WARNING: order matters, duplicates will not be added, if two # repositories hold the same package, it will be fetched from # the first one listed in this file. http://ftp.netbsd.org/pub/pkgsrc/packages/SunOS/i386/5.10_2009Q3/All 070701f2f070a8000041ed0000000000000000000000034ad9ca6d00000000000001220000021fffffffffffffffff0000000900000000root/opt0707015db08da5000041ed0000000000000000000000094ad9ca6d00000000000001220000021fffffffffffffffff0000000d00000000root/opt/pkg0707015f30801d000041ed0000000000000000000000024ad9ca6d00000000000001220000021fffffffffffffffff0000001100000000root/opt/pkg/bin0707017049c071000081ed0000000000000000000000014ad9c47000032aa8000001220000021fffffffffffffffff0000001700000000root/opt/pkg/bin/bmakeELF;4&4 (44o !/usr/lib/ld.so.1gd  !#%&'(*+,-/12368;=>?ABDEFIJKLMOPRTVWXYZ\]`abcdefjklmnopqrtuvwxyz{}   "%&)+,/01479<?@ABCFGHIKLMNTUXYZ^_c "$).04579:<@CGHNQSU[^_ghis|~   !#$'(*-.23568:;=>DEJOPQRSVW[\]`abNr  #:0  A} Q7Vt5^:i9qts z: pN D5r lF 4:D7$6O ,V  P1 e :8&do 2 <P MV:]:eY@ u D ; d5| r :s Q 468tW 2 H &5- =45F49M4XP a7kM| vT;pnr < xI 5:XJP ::d7l% p h!e 8 'E 1Fl <l) G:Ot _f lPv# z7 T58p  [ 8D9J 6 ;u& 8   / 5:=$5Do+ OD6T8] b` j9q6y8 5 ;t 5G hy p LO< ,\ |H 6$; 4 :4#8b 14 =6C8J85Q܈ \T6b4h w: hN> Lj 7rS : 8O ht E LA d b A (6/>t6EH O7[L jt xln D;c9H 5v $8@K <{ 8r/ M : [54;$9R 1:;i Fw Oh Z489_mM m4w78 D^  e :Ud9:  xm K $ n! U! N5:   , 4A< S ^Dz g9+8 o7yd!D:S T88t Y  7 . D@ :dn  HF  vz #  3 T79  J [ 7b l T9y 4Lz p : (J u& 7 4 9 : 47 d8 D t8 4 4 $72 6 Q  ~V  v ( 50 8 : 8B 4/ N + [ ,y f ts q u$ } t7 9 y  : D8   Q ,   h : 8 lo  4  t:$ t. 0 Pv : xV F ܛl W :f ; m :T 9| 9 k 5 8  T d> d:  5 8 r M $) @s  pZ # 9 E I  X T a L( m , x 4 LEZ  8 d;" 8 % TG 6    (   J 4 :9' @/ 0 ȱ B 8J 7Q tU ] 8W; . j `H v 6 6 $: : v  r  6 l ) t9 ] d6 ~  6 HY@ K 8 !O8 (tv4 c4!5Dr[ C8QT:W  Buf_AddBytesDir_PrintDirectoriesignoreErrorsShell_GetNewlineTarg_PrintGraphpipestrrchrdebug_filegetppidDir_InitoldVarsLst_DatumMake_RunstrchrJob_SetPrefixstr_concatfputsmemsetutimeBuf_GetAll__longdouble_usedSuff_AddSuffixSuff_ClearSuffixesCheck_CwdnoExecuteVAR_GLOBALParse_ErrorVar_ParseCompatRunCommand___ArgvsrandommemmoveSuff_AddIncludestrlist_initLst_Destroy_endLst_InsertAftervfprintfDir_ExpandTarg_NewGNprognameTarg_FindNodeSuff_AddTransformfopenpollSuff_DoPathsParse_AddIncludeDirHash_EnumFirstmemcpyJob_ServerStartsnprintfsscanfdefIncPathJob_MakesigdelsetArch_IsLibsigsuspendSuff_SetNullVar_EndArch_TouchfseekcheckEnvFirstStr_FindSubstringregerrorkeepgoingabortLst_AtEndSuff_End_environMain_ExportMAKEFLAGSdoing_dependLst_PrevParse_Endbrk_stringLst_MemberregexecLst_ForEachFrom_etext_finiTarg_PrintCmdsigfillsetMake_UpdatestrcmpwaitpidJob_InitsigblockHash_DeleteTableparseWarnFatalunsetenvArch_MTimeJob_WaitregcompTarg_SilentperrorMake_TimeStampJob_CatchChildrenexecErrorDEFAULTstrlenCond_Evalfreadbmake_strndupeunlinkgetcwdstrtoulLst_IsEmptyVar_InittoupperDir_End_exitbmake_strdupTarg_PrintNodeLst_InsertBeforeBuf_Initstrlist_add_strVar_DumpregfreeHash_InitTableLst_OpencompatMaketrwdSuff_FindPathLst_EnQueuevforkfdopengetenvDir_MTimefclose__iobMake_HandleUseparseIncPathMake_RecheckBuf_Expand_1Str_SYSVSubststrcpyCond_restore_depthVAR_CMDLst_ReplaceBuf_EmptyDir_InitDotParse_MainNameParse_FilePrintOnErrorPuntLst_DeQueuestrtodmalloc_optionsfflushTrace_LogsigemptysetArch_LibOODateTarg_FindListCond_EvalExpression__assertDir_PrintPathstrtol_DYNAMICDir_HasWildcardsfilenoArch_MemMTime__fsrlseekTarg_InitArch_InitcreateLst_Concatbmake_reallocchdirSuff_EndTransformqueryFlagDir_ConcatFor_EvalDir_AddDirdup2Suff_FindDeps__fpstartopendir__ctypeVar_ValueVar_ExportDir_DestroywritevtouchFlagTrace_EndHash_FindEntryStr_SYSVMatchVar_ExportVarsSuff_Initvar_ErrorMake_DoAllVarbeSilentMain_ParseArgLineJob_End_lib_versionArch_ParseArchiveVar_ExistsCmd_Execsetvbufsigaction_edataffsstrlist_cleanexecvsigismemberDir_SetPATHCompat_Run__1cG__CrunMdo_exit_code6F_v_Parse_SetInputFor_RunallPreciousJob_FinishDir_FindFileTarg_PrintTypeMake_ExpandUsefwriteHash_CreateEntryjobTokensRunningkillpgshellPathgettimeofdayArch_FindLibatoiArch_TouchLibTarg_PreciousfcntlsysIncPathsetrlimitstrcspnclosedirstrcatPrintAddrmkstempnowforceJobsreaddirSuff_IsTransformTrace_InitVar_SubststrncpyLst_First_lxstatParse_DoVarbmake_mallocVar_AppendsigsetmaskTarg_IgnoresigprocmaskstrspnVar_SetVar_DeletesetpgidmainMain_SetObjdirDir_CopyDirJob_TokenWithdrawShell_InitjobServerkillFor_Accum_PROCEDURE_LINKAGE_TABLE_strftimeParse_IsVarJob_TouchCompat_MakeHash_DeleteEntryvarNoExportEnv_startnoRecursiveExecuteMake_OODatesigaddsetshellNameLst_FindFromHash_EnumNextlocaltimenot_parallelstrncmpDir_MakeFlagsTarg_EndArch_EndJob_CatchOutputCond_save_depthsigpause_GLOBAL_OFFSET_TABLE_Job_TokenReturnJob_ParseShellLst_LastLst_ForEachLst_RemoveatexitParse_InitLst_Duplicateerrno_get_exit_frame_monitordebugLst_AtFrontDir_ClearPathwaitLst_CloseJob_AbortAll__fsr_init_valueLst_FindLst_SuccStr_MatchtolowerLst_InitJob_CheckCommandsmaxJobsgetpidDir_InitCurSuff_GetPathDieHorriblystrerror_xstatstrstrqsortTarg_SetMainTarg_Listsignal__environ_lockLst_IsAtEndgetrlimitLst_NextmemcmpTarg_PropagateexecvpSuff_AddLibDir_FindHereOrAboveBuf_DestroyTarg_FmtTimeSuff_PrintAlldirSearchPathfputcCheck_Cwd_Cmdlibc.so.1SUNW_1.22SUNWprivate_1.1/opt/pkg/libeyoqN y8485A2nc3 S& $%(,10=48v<@D,HeLPWTX~\:`YdLhRliptMx|BQ7G^T-4Y U h$(,0C48< @NDHLbP#TX\`@dLhOlptBxl|\w965%%h%h%h%h%h %h(%h0%h8p% h@`%hHP%hP@%hX0%h` % hh%$hp%(hx%,h%0h%4h%8h%<h%@h%Dh%Hhp%Lh`%PhP%Th@%Xh0%\h %`h%dh%hh%lh%ph%th%xh%|h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p% h@`%hHP%hP@%hX0%h` % hh%$hp%(hx%,h%0h%4h%8h%<h%@h%Dh%Hhp%Lh`%PhP%Th@%Xh0%\h %`h%dh%hh%lh%ph%th%xh%|h %h(%h0%h8p%h@`%hHPjjRt_hUtt P7Ehu ThRU RPԟ蓪PjURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]USVWLE]3Ƀ(Mtiteu$uD EPEPjVSχ E؅t P2U!tEÍXEC(tu us}tjuuj[E[3ҋ˅/EEE E)8t3F˅)8u8uq$tFB EPEPjuVچ ؋Et P=U!uܺ˅{)t8u둋;# W8 uẼ WM̍DEȃ PXẼ WuhHuPjuP5usKO Wu譓 joẼ hEău58W=u1E uܔuE WEH9MvEEȃPu4Eă WuhHuuWjuM4_H Pu跒uxNjulu1juWj蔋Ẽ PEȃ u MȍDEȃ P薐EĉE uuhHuuj$utCWuu0ju`3H PuʑuuEPuk uIu>3҄k uu u` uK}t uFt8uE03 hPe_^[ÐUM EE MUSVW] j/StXhAu5h!ӓt{ PpSVoXtp SvjSPIƅPV#Xtp3}thDuSVjjP&jh8P j| u|AAtjQiVƅVjj}G9j ju j@PSSjjN~=t " N "8tA8u "hEPEPuEąE EoEPWWEPu=8t,EEV$$h<5: !u0~=EED@u 7-EE~=tw }s j`!t!=~=8u]~=8t VuWh`5: >=t'uWu uWu }}t?u EPWyuR"8u?u^W W "WPQ  ";At+$ED@u Eȅt PE̅t PÍe_^[Ãh(jɵ뼃h(j赵먃hj衵딃hj荵USVW];3E 0 EPEPj5:GP[ MI =U!tP8;t@8u8uEEt PE ue_^[ÐU}ÐUSV3E= "MusPQMuuKM8tAM8u9(uy3EPEPS~AtuPS uEt PE"M "|  "E8PhqEjPEPLM8tA8u =tS!tNM "}t "uPQ  ";AtEt1 P# uEEe^[Íe^[ÐU" t u@ t t")wV$llEEo@"bHx&u@"3M@"@@"3|uHx|u@"EEBÐk5l5l5l5l5l5l5l5l5lk5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5l5lkkkk5ll5l(llUSV uV|؃t[t+uV V؃t u>70 V؃ t V&t  Íe^[ÐUSV uVd؃ t@ Vu$t j V P5Íe^[ÐUSV uV؃ tA Vyu$t j V PÍe^[USVW]u "E"EܡE t uF t tu-"u#((8t 8u"th"5" uMu}u(E"Eܣ"Eu ]Ǎe_^[ÃVhjU ju j'u2E3*u ju3ɋE3 ÐUSVWEX@ t uC t tet3C{lt]jhPt<; H @v <jhSqtj;@wJ t#ut TJi4{f*((wSPu_u6@9H <~_;M@ tpjEPSWt1}t3A* e_^[Ãhj3hj  Vhj3@j@hpjȫ눃hj诫\hj胫3CU+ t u T 9Ev PPQhXj<EÐU졸  Uu ujÐU jc8 jc"jh"%uUj\"@"@ hT] "j" Py%ÐUSEt>Pj<؅t*C"t;tH 5""e[ÐU="t&5"5"cP5"dhPj"t "@6 58Ph8އjʐUÐU58h058c 58` P^;"58"0h058ctI PR^;"t ;"t580h0j 58bu="t58"0h0/="58"0h0="t58"0h0="t58"0h0 58btA PS];"t580h0s 58au 58[UEM M EYUSVu333ۅt5փSw"$\wKC IAFu ȅ#^[#w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w#w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w-w>w*w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w8w>w5wUSVW,E 9.uzyutMQ Pp#؅uEEԍ{ VWt#{ .u>.u WWPuJY EP3#؅u{MQ P"؅tbuE EԋEEЍ{ VW7t*{ .u>.ujWE0PuX EP"؅u3e_^[ÐUSVW,E XH3҅t%{t}uJхtB@u@8@E PM M̋UU+ʉME؋;]EE܋EE,t#3Ƀ{t}uAыȅ~ AF,u߃ E+@P/83۩th5:dTuG"tVP"tuP u Tu TtlMPu PO;"t);"u uPP4u V6Tu VHN u 5NTtM"t"uuP"tuPK8th5:3s8th5:԰Tu-"t$SVP t?"3 u Su StgMPu PQN;"tSPPu VRu VL?3 u LTt/"t&SuPVt?X3Q8tuh5:误"uh" t48thd5:pEEe_^[GJXPut)8thH5:#3}uEjuh"ء8t% uNuPh5:ǮEC uI,8th5:荮"3Ǎe_^[ÐUSVWuhD8hP|8P]8 u 8Vh<hHP@XHPQNu\} ;tQ;v;/t K;v;/u WVh<hHPXPHPu3el%=@t4 HS蕬H;vH/t I;v9/uHPhDuuie_^[ÐUSVMA XBYuRuO QPu6ء8t#tP6h(5:訬u E0G؃Sh"tH8t# vSPh5:LFEVh" YhPSt|}uFKEx Ct*8tAt8uj58Qj9؉]܋EEt,8tCt8utw33tK8u=:t$t\t)t }u F 3t8tÃVS WPu=R uMAI ;r3…uLju萼E#3e_^[ÃhhjsߋEp phjTu<돃hj5uf떃h$juBoUSE8.X@t*8tCt8ujhSuWK8uu>8t5h5:H^3jhdSu@C8t.8t5h5:苡 u蝠 uP5##XKH#;| P謹#@ De[ÐUSVWUtO(t{u} 9)Jt&;t ;uNuF @u33_^[ÐUSVWUE @MM)tL MCu$t6:t \t;Mu^~GF;| V许F8\D87 SuN~GF;| VuF8\D8~GF;| VPNE9D9CPGPVlECȄ=$ SƞM]E Me_^[/e_^[ÐUSVW3҉Uȃ$t`t \t"uE\AEU؈ E@EAuNjEEԋE@ Eu Mԃyu,Eԃxu 3ۅEx8 t!qhx5:ڑEԃEphxEp 趑Ep AEԃxExIEԋ@$Ex48+E@ Mԃyt_8 t!qhx5:)EԃEphxEp Ep gEԡ8 t"u؋Ep5:ɐEԃu؋EpEp 觐Ep EԻEMQ,;t tA$E Eԋ@ E3!EԋEH EUԃzoUԋB E̅P8G tn18 t"u؋Ep5:Eԃu؋EpEp ďEp &@ Ezt_8 t!rhx5:{EԃEphxEp WEp 蹏Eԡ8 t"u؋Ep5:Eԃu؋EpEp Ep [@ E̻33Ex uzuf8 t$Ep hx5:葎EԃEp hxEp mEp ώEx8 t!rhx5:.EԃEphxEp Ep l8 tp hx5:ҍp hxEp 贍Ep 8 tp hx5:|p hxEp ^Ep Ex 3Ex8h5humE@u_8 thh5:ߌhhEp ČEp &MfAf fA WOE܅ 8 tPh|5:kuh|Ep REp 贌8 tuht5:uhtEp Ep h8 tWu5:׋WűEp ‹Ep $u蹊E؅t P覊utE@ufxt[8 tphx5:GphxEp )Ep 苋8 tphx5:phxEp ΊEp 0taxtV8 tp hx5:臊p hxEp iEp ˊM܅8 tQh|5:-uh|Ep Ep v8 t.EP58h Pht5:̉EP58h PhtEp 螉Ep 3Epu(3e_^[ÐUju ujPp`%3ÐUSV ue$uvg^jV}uvC^e^[ÐUSVW] 8 t! SEH10hT5:諈 u3EtE@t- uG}uK uuF t=4t P%F tQuF;#t&055#h4F#F˃Q0h>8 u)uF06h85:螇tkuN; #t&155#h4iF#NFu PW1h薆FtS3O8 tCF;#t&055#h4F#F0h8 h48u3juFu tHvHwttS FGFtNQhPq`&F@F vXF= t(=:u=tu t1t#=u=u Ee_^[fN] e_^[ÐUSVuF 8$"} tu =:tR =:tG6h4SbSɅF u=: =: ^u4MEEQS}|hhS|gEjPVujjV† EjPV Vue^[騘ue^[e^[à 58PSh4SLS賄ȐUS]C  s`J&yC t s0*&Y:tq p` &u_C uUS5:S EPuhjuPh<E P艂 S@MA Q uU=:t0 1hh5:hT4S St3p1hh5:hDU 3T 1hh5:hl4SS(!15:hh4蜂e[ÐUSV MfAf%fA8 toh(A0h05:Dh5:1:] t QhdP: uhP]K9 #t.Cu#155#h4辁C# EPC EPEPs 考jP腃Ljjjۂ jjj=C@ t'jj5'諂 jj5'虂jsjjjojj袂Pju 5ނ5hIjq3Sj3M( Q]C t=4t PC 8  EPKe^[ÃhhIj~hhHj~hhHj~ 583PhmG3C0h5:Vh.USVu H4tA9-u @0t8-tE@uCFUBNBuH0E@tg9-tbuu@0u | PQhj h+} =+t%F+u@0tCe^[ÐUSVW\u ##;s{t,;r h\Eh,jS2CMA tK3CfC Qft fCffC ulfKtff fKhuFEC EE@ u;=:=:t?C 4CPuC =:t: :L}uaE EP5# | P5#W}hPW W'E8 EPh(u~C uWh\DC Pu~ jjP}#ShEp`o=#u W"{C W{s c|EPSjS;EPSJ3E9#t#055#h4{E#4C }tShEp`C P{CuC =4tt P+{C }tH=u4CtKQhPq`yC@ s}MC Cu e_^[à 58q{Ph,B WvCUSVW] @PSÎEEEE};tp=:u:}t4E@;#t&055#h4zE@#Shh4yh4YzX;t?C t t uC t t tpS?] Íe_^[ÐUSVW,E E}G$Eԋ(+PD$Pwy| (t'E=8 a8 _(3u3҉UD$ (3҉Us];|+T# tu  (JN;}(3ۍ7E@$;(j$PuWE8tj=:u.G;#t#055#h4IxG#uPuhh4xh4~x]؍C;|3LJ(+KSE܃%Puw(}gEE e_^[à h?zUEPPExtà hAECvUSVW=HjDuVjy+8 tuWh5: wjW4؅E< 8 tC03h5:vE=uV<uC0h\u1<uC0hpuQC0h<uC h4v$CECuSC =t"jDVjxe_^[ËEPWh<USVW h47v h # IQ +PIx؅| h8#st,EKjEP5P#u}Ru= #u hh'~_ UT1t-Uzu!jR\E G;|e_^[ÐUju^U=uI8/tj5h4̄j/Ps@x4u@40x0u@0,ÐU@(ÐUt Pr458hyuj58h`hcj58hj( ÐUSV 8i,P5# 8i,QjPt8i,# #3 # # hu؅t;u SrFP #SPs#|0/thPu=8t # #]j@Sj)uu jh8#8P  8P  hh' h8# h(#shjrjh(#tjjrt!jh(#th,jorjj`rt!jh(#YthDj:rjj+rt!jh(#$thDjrjjqt!jh(#shDjqjjqt!jh(#sh\jqjjqt!jh(#sh\jfqjjWqt!jh(#Psh\j1qjj"qt!jh(#shXjpjjpt!jh(#rh jpjhխ؅t S?{tjh諭e^[à h:jnUjh(#hrtjj5pjh(#Crtjjpjh(#rtjjojh(#qtjjojh(#qtjjojh(#qtjj|ojh(#qtjjWojh(#eqtjj2ojh(#@qtjj ojjnUSVt]PSimt 8u3ƍe^[USVW\u8tF8ut Plj8jEPnEPjEPVz~؅KEE}E8jh7mu Ejh7lu Ejh7lu Ejh7lu Ejh7nluE PkESj h7:lu  E.jhx7lu E j hl7kuBH TЃt#‰EYЃy##EEjh`7ku EjhX7qku Ehjh7Oku EFjh|7-ku E$jhL7 k@EԸEEHMEj/Pjt@EEEtE}tl j8MUPMUHP MUHPMUĉHPMȋỦH P$MЋUԉH(P,M؋U܉H0P4M 5)-E PM x txt @xuxu @x u@ x Sh3ue_^[Ã5hjRSh̓uhjQSh먃hjQS{h놃7h4jQSWh_Vh/DUSVW, EP #5#;} ~^K u8 S謨t #!CEԅuEԃ=: #t58 tQWh5:mhWQj #,;g EP}t5=:u,jht: P]jj6u fe_^[à u0u #.uhk. #UtC p` t p0 u= u 5 à h-琐UÐU=t'=uÐUS=t? ##;s0{u j3bhj 3Vh #,;rЃEj@Pj$i~]j@Sj ie[US ##;8{=t u){ t3hl5:e{t"C0hX@eh4CfCj3pgt98 u #03h85:e8 # #8{usS8 #,; e[ÐUS]{ t h  -S fL  C e[USVWEEP u h,EP +Ӌ5N ;tE#yIA+э<Ltt   P E@ e_^[ÐUS]C u h+C @e[ÐUSE+tEEjP5'cMu%]+tjS5'cMtޡ8 t+Pe RQPh5:=c EjP5'vde[ÐUSVWLM |E| ''jh'PB5'5'hEj@Pa58hhӷ E58Ph輷]s~9ƅ3|";~; yG;~e_^[UHy h*=u+t)ÐUS3 #8 t(c 55Phl5:a =x89gjEP5'ao}+8 t:cMQPh5:4aEjP5']a 'u]jSQ@a 'tEjP5'.bh=(=ubEjP5'bI=t@8 us8 txbPh,5:t` #378 t/t" Vh+hhHVO XPVbupl%=@u^ VTSukhVh/Oj58h/hx謢 jh/hP,SHt WNuÍe_^[à 58dPPVhh4O뼐Uu u USVW hRh Rظ4:jhPyRhlPtRj/} 7uN:t@::pPjIRt(t;ptppPj,Ru|j58hhp0j58Vhj58h`hlj58hPhTjl: jZ++ j>+3:::::::+:8+585+:+\j587hH9j587h "j58hDh<j58h0h4j58h$h(ԟj58hh躟hOuj58Ph莟NPhxj@PKjx58PhV2PPhxj@PKjx58Phb hOP\Wu@hh+OPh+#=+ hPN hNuo hNtj$PJuIHPWu2;Xu$;HuhWh+Jj58h+hhh+譈h+DhMt6 h+PhhP-JP hMt P hhLhhPIPuI hLu5 h+hhhPIPV: 4u5:a辆 5+3: h4Mjj05:tj58hthxlF 5:t/ V 58Phx诞Vvuхt;t SOIހ>t:tGt:u:uGjShpHu;hPSh+聚t,P54=S54)߀?kIt VG=+uk j54u44SPhl^S"hHjS' 5+Ut*jh0Ot4jh$9 hlj5+=+t =+u&8jh`8dP58h<辞 58Ph(蒜dt PdF=:u585<5+8 t45:5+58585<h5:F j jjj5:hdtbj5:h@j-:tt F:tuP58ԚF:tà WjEg8t jӍ=+uz 5:Quj5:讄U؃=:u+=:uM+ S:* Si3 5+3ۅd Vmj$SD 8tjQSjdWQS芜uPhHDdt P*D Vs3ۡ8t j腌jj~虁\bT詃觎e_^[à 58AEP5:hh4xDjNC; 58EPh+5:hh4:DjChl5:hP|  P P5:h<W  P P5:h<2 USVWu h`hVBh`VBEh/h+B>/ h+^BVSBD=EvEPS؃ Vh+huS#BjSCt h/AVAD9EsEPS8؃ Vh/huSAjSBt}jVBuh5:V菍Eu5 54gu44PVZEtSju/Bt.u}tj58Vh腔WVMb u@ S@O h4CPPEPhXLj58hh Sl@3e_^[ÐUSVW=0 =358h跗t308th5:@3EP58h 3j/P@t@33333EP58hh諗,u ]  hCu hBFEEEؿ3 }3?L8MhDPC;E;t&t|t )t3R}t-EHE;t&t|t)t߃}tڿ35:hh4j? M;tJ&tE|t@8u }$h}u? Qh<Vh5:? 8u;tH&tC|ul< Qh@Vh5:> M(t{t;t &t|u.AM(t{t;t&t|tu hQ=hu=3t6E3 PW=E0uw=tIE܃E܋uѡ8thP5:=F;ua8t%E 5,M1Ph5:= ,8th5:}=3t3p8thH5:S=3J8thd5:-=3$8th5:=3e_^[ÐUSV=0MtrEPjEPQM8tuuh5:<jVuE؋Et P;tD V|;6E3Ejjj؋Et PH;3ۋÍe^[U=0uQM39t @9uuMQ:-u qjuPt E>ÐUSVW<3] 395uDžE P<;tZua ;j`=r; P5U=j9x /;jPThS:~&SPW=S hS:ڃu =8t : jPV<;t!|jSV<;t}鋝jPSu M PvttM  M 8~J| uDJ;ri+A;s3Ƀ|4H: u z uB z uB z uB ;s;r%: u J;s je_^[ÐUSVW :4u45:hS9 E PuS<hPS8SZ9:4;ue_^[Ë}] PhV8 SWV<hPV8V 9뼐US=+tTE Pu4SG<hPSY8S8j8t jjjbj6e[ÐUS5:h4S7 E PuS;hPS7S.8je[ÐU=+t8t jjj謀j>6UMtPQhÐUhPu6t#|%=@u8à u:UH:E P5EE P5EċEEȃ P5E̸EЃ P5EԋE E؃ Pz5EܸE Pc5E 586E P@5EE P)5EEjPj9ÐU5:hh45j4ÐUuh53ÐUSDEtPh4h+5:h4 j?EhP4jE58Pj؅t";tSh4 S%4e[UHE9(uO3(j@EhP^4jE5:PjPt8tjPh7Uu h5:4h`u x h`hy53j{5UE @M;A ~A 3UME E M֐USVMA 0$ Q҆8ȃ@uFEp   u"x]Cuh5:3C # Ps Ph5:c3C  t)8@tht5:733 Exu8@tO uJtf8@thh5:2Ext PqIt :Ex u@  3]s to8@tOhX5:f28@t-Cu8@PhD5:-2E@8ȃ@"]CS ;u?t+t3h5:1t^uVCt th5:1C؅EPhp,t2h5:?1th5:#1_tVu8th5:0.h5:0h(5:0Íe^[ÐUS]Cu>C  u48@tCEPShYC uEPSh4tVPh}Et P&F u*C9F|;4|2{u,VWh|{uVWh|Et P|&3e_^[ÐUEPhh p0 EPh| p0suh}ujuhhyuh}ujuhh~yMA t;EPQh}juPhIyEt P%ÐUMy}6At,8@tAtrVWu 8uM!tH:tC(t>$u3 EPEPj5:V~ Et PuNF>uVWxu (U .t3 B8u=3  R.!k |=3u  3EЃU$.3?:08! hNEԁH P53Eԣ:juqOH P53}u j蜲Ẽ58u豭 5:guv3 jhuuN3 EP2Eԅ}u j Ẽuu!3 t%E.E8 uhQuuuì2 j舱EԃuPu7Vhug uMub uEԃ P+t u+juMP53*ut3 t}ۻtkVWDu3ۃ!tP3ۃ:tI3ۃVW u  t tF>tVWu!t:ut3t*8tFt8uu#5:53EP[E8uWleE!:MyjhT u)tIjhL ut0jhD u th j{h jzdjuE53+u!3tttt !t%:F8:t EEE^EPh53ɭFt*8tCt8u];ux3$-j58h h _kjhP"uIKO:C:7:+'$3w tu 3.&E8E؋E؄t-8uCE؅t8t3wr$L- u3[ u{DK uC/; u.+uh4"uh3u+E؈tCE؋E؄t*8tCt8u]E؅tE8Ȅt@8u5U(u ;v{$u#C t8u<(u (tCuuq j" 5:SEPY Su& S詨0uSˬtڃjSŨ]t*8tCt8u]m S9AE S!E 3w1&t#E̅tjP"=3uH=3u/jh"53E؅tjPܧe_^[Ãuh jh| jph j랃EPh j냃h@ jKh$ jkjuh jQPh j:9uh\ j  E*E*E*E* *E*)E*E*E*E*E*E*))E*E**E*E*E*E*E*E*2*\)\)\))\)\)\)\)\)\)\)\)\)\)\)\)\)(\)(%)\) )\)1)f$-$f$N%N%f$N%N%$N%N%N%$N%N%$N%$N%N%N%N%N%$USVWU t uB t tZȄ33(tX{tS)tK}tFuF t uC< t< t=t;;=u+t*:t%?t !ttNFCȄu3 3U_^[ÐUSVW] t uC t tK3҃=t?(t,{t')t}tu8t JBAuƃ=uyq!u A}+u Am:u3A`?u"Au S\9;v:t O;v?:ujhWt8tF8utju VS(X3j$V3tj5:Vj֚EPVwEju PSWu*Et{=::u S[uju h SWju VjP=:ju VS]Wu VSY3h StihStAh St%h Su7jVJU'$ V-BC jt V ]e_^[ÃVPjCFUS]C t+ s(u s(P胡؋C u"u s`S3e[Ã3hl j3h@ jslshB ːUS] s`XuK e[Uu5:ZWUSVWE8/t3 P违} z 30虝j/Sjh3u.uX}CEj/uEt8hPt#EjhWtjuVSx5:WCMt WS58WMW Sj.ut% P"tPuLuj5:uLuP58uLu6 54du44PuULt=jV-u}t2ue_^[ jjPjV }te_^[ÃVh j 빋EEE , Ee_^[USVW U:iL2D2 t uA t t"t "Aمt;t Ct;u;uWj5:Qj芕 V>PS]e_^[e_^[Ãh j#Wj.h jАUSVWj/u؅tjEE+ GP0 WuV1>j58Vh Qj58CPh Que_^[,j58h h Qj58uh Qe_^[ÐUSVW3E u ؍EP58hUt@t<}> uFSWVu t2 t-j Vuǃ58uhtSEt PIe_^[ÐUSVW ]t S038t#uuuu Shp 5: }=3t5353< j,_3M 3H3H3x M3H$U3P( h 3A 3A 3A3@ u=3t5353腙 j,託3M 3H3H3x 3p$M3H(3 p(P$t; 3A 3A3@9 3A]e_^[3Ee_^[\]e_^[ÐUSVW ];i|38tWhP 5:D38tG8uj5:WjT؀?tx t,8uGt.8utVjRW밃VjRp]e_^[be_^[Ãh0 j䐐U3H$t7 p(у 3A 3A 3QQt  3p73@  3p5353蔘3tE 8t p p0h 5:c 30+58h G58h G3à PaEUSVW<53EȃMEE Eċ~F}ȉ}33ɉEЉMtD\Ot}u}Ѓ uF}͋F;t;tqF;^N+EFE܃ E؃uQPZF+E+)E)Ẽ})EЋMԅt+ȉMԋE؉FE܋ML M؉NVUF +уU܅PurNMV+ЉVV+ЉU؉VM+U+ЉUȋM+MȉM̋MЅ+MȉMMԅt+ȉMԋE؉FE܋MD E؉FVN M+ȃM܅rEPRӓNMV+ЉVV+ЉU؉VM+U+ЉUȋM+MȉM̋Mԅt+MȉMԉFEF F uuv ~EE؉F#tG t4 }uẺEG8}E~EȋM;t9Eu }}tEȀ8.]}t}tEȀ8 t EԉE}UЋ]ȋMAM<\t rtaXquЅtQ#t1r u4A t uE@E t t rMȀ9 u \^֋J;v)B8tJ;vB8u+EȋM E+EȋM +ȋEĉ3EȋEȍe_^[à 58 Phjw3E̓hj^3EUSVEPj؅;. Sx/t̃u-EPj؅t SL/uمt[뚃uT SeOtD|3XuVjLt, PRuރ StXC3ۋÍe^[ÃhjrАU=3t?jhR53-h25333ÐUSVW 33p jju ju` N8tW3ph5:P?. w8tF8ujSVst-ujSFPjhVusVF8t B8u8utF8uu58RA jhxV? uw<jSWuG8u5st-u>jSGPu(G8tj:W 7 W%t58W\t!\t;t F~tFuu3Fj5:Wjχ3tjPn j]33 WjW 8tF8u=3=3ts V茌 Ph,253ԑQ W>CNF8tA8ujQ[B V==pu e_^[ÃVhXjX>5:h$h4j.Ee_^[U33 jڑ: jȑ4 j趑4 j褑3ÐUÐUS j|ء3tE@ u53S职753Sm j3p(Sƌ hط5830h DÍe[U3MAh3@AlUSVW uu D;P% SuV&Eut /C CGWu Pƍe_^[USVWx t8u uVtnuuVahEԋ@ Eԅtx uˉ}ԃ}Eԃxuj0 MԉAuԋ~ EE܋FHdtIFNHdF@d@Guj7R GvwvPIG;Et1H jwwh`GjP0hdv ~ oEHdtINHdAruF a vE܋@p 6 F2jVPhdV}wM܋I+qGdt HE܋HOdAGMj/wt@GjWPh`EpM܈8tE0h5: uF uu v586$FtPjVPhdtuFdtHFdj/vt@FjVPh`5Eԅt$Pu kuuu e Su ut" Su uuރjSu e juu ee_^[ÐU54u654P 4t Q: 4uÐUS]C  C 8t3h5:VC  t~hMh54gKdtIt# PeCd@p S'CdjS3hdjuhh`q&E E ]e[E E ]e[e[UhMu54-gt5 PMe3t fJffJfHffH3Ãuh|j臯琐US 3jFh4 j4h4 j"h4(! j$a33 hxa 33X jg 3A 583p jg 3A jg 3A j{g 3A (!H (! 3A3f@3@e[ÐUÐUE0h5:3ÐUSVW ]s3hh5:s5:hd V=:H#;uhWM=::uhW/=:uh\W=:tWj|InWj)65:j #hT5: jhpsd5:j hH5: jhpsd5:j h5:Vs 5:j 3e_^[ÐUS]3h5: s 5:j ? jhPvs`%d5:j 3e[ÐUh5: jh8p54ch05:| jhq54cU jd4hh4&ÐUÐU4ÐUSVW jp]u]3ۉ__E8-uxlu G G 3wwDG<wHwwwLw w jcG$ jcG( jcG, jcG0 jcG4 jcG8jGPP%jxcG`wdwl_hǍe_^[ÐUSVE t u7EPuh4&}u^h u؉^58uhS54]=8t$K uh4%tX3ۋÍe^[ÐUSVW j~bu)d ucu t<} P^VPt PSM] Wmcu@} P^EVPt5PS ] W+cuà u=]Íe_^[Ãuh$ÐU=:tE@ @U=:tE@ %ÐU=:tE@ %ÐUE4ÐUMAuh|5:nC uh5:NC P jh(vs0uYh5: jhPvs`PYhx5:C tEPhys(Y3e^[US]C uBCt  PQhl5:萸s )h5:r3e[ÐUhX5:H EPhy54yXhx5:h45: jh<}54>Xh5:58MQh5:·5:,Qh5:衷h5:膷UMA tQh~q(W3ÐUE @ M A 3ÐUjh~54^WUS]t?4EP58h"4hS\4e[ÐU=4jEP5454E48!5uEQPh54\0E t%Hq PR01h540 54j m54ÐU4t PݵUSVW];.K8$phS8hSô<hS蠴us@lhS脴uWDPh Shu;H4h(SLu\hPS2uLSE PP:ucut):;E tSPP=:u1t /=:u.t&8;E tSPPtpu3 Su<=:t/t'8;E tSPPtp[3W3S jNSN WENM@PQ WuuRF]ƍe_^[Ð.......ހ...€....`US]Cu3, 3/u CPue[ÐUSVW jM؋E t P3{FPW u VWG3CjuEPPkX 8t! u uE0h,5:R e_^[ÐUSVW ] PuS8t/t( PuE 0h05: tY~Gt 7KN ;t PưVSjGP}e_^[陰e_^[ÐUSVM.Gyu!t%t *t@u3(j58QI؅} C0jCPj$V0t[uhhP=j58Pj4F jSuܳS裯gCu]jVu足J3SjCPwj$V蒯t K0&c߃jVunK33e^[ÐUSVW,P!hhP=j58Pj6EQjQPw؃~3j6G;| dVSMDP8PPdt%j@0S[ue_^[USVW} E8j58Pj:DMEQjMQP脿u܋E 3{u !tS%tN*tI@tDjSuE-=P!t P!58ShREG;|P!j58uj~CMEQjMQPȾ؉]܋M~Q3xu!t7%t2*t-@t(jP%Mt=P!t P!F;| u腬uzuoe_^[USVW\uj$Vz3ۅtMjuVjB؀;t28tu Vh5:]e_^[EE;8ufj5:VtLG@t48 u VE0h5:膬 vjW/juVzGE Pzu [ u Pu8t u VE0h,5: GtjViE;:u}Eus<uu VM; :uTEuJjQVtO@=:tju V踮58Vh|E;8uKVhp蕪u6 u ï@PhlEj@PN EjPhpKt S tjWue_^[ÐUSVWuj$V3ۅtMjuVj0@؀;t28tu Vh(5:z]e_^[xM; 8t3PQVaGE@GOM;G| QG M D u ! u Pu8t*juPVE0h,5:輩 Gt2GjVEPP{xuu Vt]e_^[zue_^[ÐUSVj$u臨tDju uj>؅tEju P+t( SuEju PtjV3e^[USVW ju u3u;t&jGPjW5t3ۋÍe_^[ÐUSVW j/u跧؅t_}t4} ?t,EpNH;| P{EH1D1 u uPu/e}t4u >t,EXKH;| PEHDMYCA;| QE@.De_^[ÐUSV}t4u >t,EXKH;| P衿EHDj/u荦t$^ S% SPu蜿/ u uPuze^[ÐUSVW uj.u؅t_t4} ?t,EpNH;| P޾EH1D1s Vx VPu.uƍe_^[ÐUSV}t4u >t,EXKH;| PeEHDj.uQ؅t% u uPu_. uȤ uPu=e^[ÐUSV]8tuuh5:[uutZt4u >t,EXKH;| P肽EHD u uPu落]Íe^[ÐUSVW]}t4} ?t,EpNH;| P EH1D1EP3u>t/jusj9uVSuܺS_ u_ uPuԼe_^[USV]uu諸uZt4u >t,EXKH;| P?EHD uآ uPuM]Íe^[ÐUSVW,]u} S蚢EGȃ80w7S GO E+GtDt;u >t3MAE@A;| QbEHUDO wQuu G QM+Qu]O1O9MvO tYt;u >t3MAE@A;| QغEHUDO wQuGGGOE+E;Q7P謡E+ÉEG tAt8u >t0MAE@A;| Q"EHUDSuu8 ww u'OEE@E؃7S貵E܅E EԋE+ÉEЅt6G t1EpNH;| P脹EHEԊ1D13Suu蝹 ww u茹_E+E+ÉE]܅t+Gt$G7S E܅] GG}tPt:E E8t/ExOH;| PҸEHE9D9SuuE@;Eȅ St8} ?t0MAE@A;| QiEHUDSuu脸u]e_^[ÐUSVW jju }WLSa:SVu W1 Vuh Et4M܉MAM;M| EP譱EMUȈD QG 7PEP輱C;~]+H#ÍxJ#;|~Mčt3tg9tbt>Et4M܉MAM;M| EP EMUȈD Q裗 6PEPO;} uiu^EjPıe_^[ÐUSVW<EjPbE ẼxuEPjEPuEE7E j2E u2EԋMAE3~4EEċEEȋu]3VMQP3uuUă G;}| u肖uwEjPݰe_^[ÐUEM M E郖USVW,EjP^EPjEPuE̋MЅU suhjQu藛MxYtÅ3|]rKx;|;t Ű<> {Ix;|;tNŰ^ _}~.Kx;|;t Ű<> KҋMЅ~_u3ۃ 6& 6PEP蛮EЍH;t,}܍GE;E| EP4E8 D8EЃC;| u軔u谔EjPe_^[ÐUSVW,EjP貮EPjEPu=űEЃ~N^3Eȃ63|tE@E;t EEEЃG;|ƋE@EЅ~_u3ۃ 6 6PEPyEЍH;t,}܍GE;E| EPE8 D8EЃC;| u虓u莓EjPe_^[ÐUSVWL] jEP菭u]̋E8OEE;AE$EEEEEEE\$t0E&0pEPxww;ME (tB{t3E܉E@E;E| EPMUĈDu}E)Ečwt.~\t ;t;EuB;EuJFtFu҃W+PEP訫  EPEPuuW}!V VPEPpEԅt Pɑu}t EE܉E@E;E| EPMUĈD{G;EtD\t?$t:}t&t/u܍FE;E| EP藪M1D1w.u܍FE;E| EPhMG1D1wt ;M;Mt E833AGE8E܉EjP78tVh5:莑] ƍe_^[ÐUSVW,uP؅u StEԃjEP航>hVuq> tV}܍GE;E| EPbE8\D8}܍GE;E| EP9M9D9F)SuԍEPVFVWEPB>\EjPء8tSh5:]uÍe_^[ÐUSVW,u} u :E;EԃjEP_}܀>t;GE;E| EPY] PUԃ;D;}F>uŃEjPGue_^[ÐUSVWEh} 3ƅ l74FE8;5M<;8tFjPQ|tjP#8d Q!DG`!t +t?u Gl GlDžjPjj}lP@PEąt PnuNFt;Et :h:E:EEPEPS ju WCEt&EjP藈EEEE E;:;8EȃtGFt DPhmEEjuEP藸EjP{Dt jhMPQu   jhMPQu E8+uFE0EjP與ju賺SEȃEȃ?.O8M ; :t ; 8HEPhW4muhPWmtjuhWmtRuhWlu|8GFtDulE ;:t;8uY!t%t *t@uB}EuFE+FM1VP E8EjPA}E jZE8EjPɅE@EjPMAMAjuTj$Woktuu WjE8E`t0}t* uMQuu PEPSFPW*0uF>u +uE0 +uFE0E@u>];t Wj}uU!E0u;jug;tju迄 E0;ju0jju&;tE83Pu詷L+uFE0EjPU}uT!%U!+uE0EjP(U!Ǎe_^[Ã1hp12USVW<] EjEP蜃3ɉ 4;MM̋MMMME< u6}}u܍FE;E| EP^E0 D0 }B$>su.}܍GE;E| EPM9D9ȃ(t{uZCt+:t&)t!}t$tFt:t )t}u$uWPދ+QEPdM;u QFhSjEP证+OQPuhuÈ|8$ttF$t u++SWEPJ[$t:KËك$tt C $tuP+QEP {$u3u܍FE;E| EP血MC1D1 EPEPuuS U!tIT!tA]ԃ V gEԃVPEP|Eԅ3El|\E\=:uP39Et=4]40u܍FE;E| EPM1D1C]ԋEЅt P[fEEjP謀] e_^[SuhTjjOhU hLʣ8 h赣:ÐUÐUjEPPE0h@5:fÐUSEPEPPt] pSue[U3ɋEHHÐUSV]Kt!t3 PeK1u Qe3MAAe^[ÐUSVW } tA]3N C;Kr @QP6CNK;tv jMH @ @0NHFHt;su>C9;u8 jMH @ @{u 3ɉH@C3e^[U u u Pu9U u u PuUEt@@ USVW uM }9A@~t1 jK H tG8@@ [uϋExxu G OHE xt]@HS9t)A@FFtPAF~tt FVB Q?a3e_^[UEt@ 3US u#tX Puu33ۋÍe[USVW MtvAt`@u t%t:{ s փS`߅utX Pq`ÅuEEe_^[V`Me_^[G`e_^[USV] sJtyty} u3s VUtExt;Xt[3ۅuD3@ s U PVtExt;Xt[3ۅu 333ƍe^[UEt P u PuU uhuu PuUSVWEt58t0u ut&}]Sv ׃tv;utu33ƍe_^[UEtu3U uuu PuUSVW,u EE؅MMЋMMԋ^t ;FEE@Fuv UЃE̋FEEHFF;t3FEEt V^}uE؋t{3E̋E̍e_^[U jq3ɉHHMH@ USV]t;t:} u8 jMH @ @{u 3ɉH@C3e^[UEtxt@ t UEt 8UEt 8t@3UEtU 9P t@t;u33UMtOytIAAt @A;t t A *A !y t 3A AA 3UMt#A9t3A A3USUM YttYX9 t9Jtzt<9Ju7A9JuBzt9JuBBuB 9 uAE}t E A QG[3e[UMt E A 3UEt@3UEt3U(juEP[EÐUjju\ ju ud[ÐU(`!@`!|hhh`MEQP EMPQj\ `!u EPBÐUS$\!@\!|hhh+`}tEP]S}u3ۃEPSj(\ \!u EPe[ÐUX!@X!|hhhl_MEQPEP_ X!UWVS[ >[^_UWVS[=[^_! $NetBSD: arch.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: buf.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: compat.c,v 1.5 2009/09/18 21:27:25 joerg Exp $H<\]<<\L^ <\x^hi<\^<\_D]D]<L^4L^0]$NetBSD: cond.c,v 1.5 2009/09/18 21:27:25 joerg Exp $O$NetBSD: dir.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: for.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: hash.c,v 1.4 2009/09/18 21:27:25 joerg Exp $: don't know how to make$NetBSD: job.c,v 1.8 2009/09/18 21:27:25 joerg Exp $$NetBSD: main.c,v 1.6 2009/09/18 21:27:25 joerg Exp $@(#) Copyright (c) 1988, 1989, 1990, 1993 The Regents of the University of California. All rights reserved.$NetBSD: make.c,v 1.3 2009/09/18 21:27:25 joerg Exp $$NetBSD: parse.c,v 1.5 2009/09/18 21:27:25 joerg Exp $$NetBSD: str.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: suff.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: targ.c,v 1.4 2009/09/18 21:27:25 joerg Exp $$NetBSD: trace.c,v 1.5 2009/09/18 21:27:25 joerg Exp $ '`";&<>()|*?{}[]\$!#^~$NetBSD: var.c,v 1.5 2009/09/18 21:27:25 joerg Exp $$NetBSD: util.c,v 1.5 2009/09/18 21:27:25 joerg Exp $$NetBSD: strlist.c,v 1.1.1.1 2009/09/18 20:55:27 joerg Exp $$NetBSD: make_malloc.c,v 1.1.1.1 2009/09/18 20:55:23 joerg Exp $$NetBSD: lstAppend.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstAtEnd.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstAtFront.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstClose.c,v 1.2 2008/03/09 19:54:29 joerg Exp $$NetBSD: lstConcat.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstDatum.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstDeQueue.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstDestroy.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstDupl.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstEnQueue.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstFind.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstFindFrom.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstFirst.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstForEach.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstForEachFrom.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstInit.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstInsert.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstIsAtEnd.c,v 1.2 2008/03/09 19:54:29 joerg Exp $$NetBSD: lstIsEmpty.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstLast.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstMember.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstNext.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstOpen.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstRemove.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstReplace.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstSucc.c,v 1.3 2009/09/18 21:27:26 joerg Exp $$NetBSD: lstPrev.c,v 1.1.1.3 2009/09/18 20:55:34 joerg Exp $lib%s.aNo t.o.c....%s modified %s...@__.SYMDEF%-12ldr+%!Replaced %s with %s SVR4 entry offset %s is greater than %lu Could not parse SVR4 name %s Found svr4 archive name table with %lu entries Reading an SVR4 name table failed Attempted to redefine an SVR4 name table /ARFILENAMES//` ! r%s(%s)No closing parenthesis in archive specification -xc%s ... Stop.Examining %s...`%s' not remade because of errors. `%s' is up to date. .BEGIN.ENDGraph cycles through %sout-of-date. up-to-date. <error in wait: %d: %s (ignored) (continuing) *** Signal %d*** Error code %d %c *** Failed target: %s *** Failed command: execCould not fork-cExecute: '%s' %s expands to empty string.INTERRUPT*** %s removed@#=|^(){};&<>*?[]:$`\ defdefineds%d open conditional%sToo many nested if's. %d max.extra elifif-less elifextra elseif-less elseseif-less endifndifMalformed conditional (%s)+-commandstargetemptyexistsUnknown operatorleft = %f, right = %f, op = %.2s lhs = "%s", rhs = "%s", op = %.2s String comparison operator should be either == or !=Missing right-hand-side of operator!=><)exists(%s) result is "%s" Missing closing parenthesis for %s()nmakemakendef%s # %-20s %10d %4d directory# %-20s referenced hits # Stats: %d hits %d misses %d near misses %d losers (%d%%) #*** Directory Cache: done Caching %s ...Using cached time %s for %s (not found)Found '%s' as '%s' %s/%s%s failed. Returning NULL got it (in mtime cache) Looking for "%s" ... Trying exact path matches... Checked . already, returning NULL Trying subdirectories... failed. [dot last]...couldn't open path, file not found Searching for %s ... in ${.CURDIR} = %s in '.' must be here but isn't -- returning Caching %s for %s checking %s ... returning %s %s ... Expanding "%s"... Unterminated {} clause "%s".PATHCannot open `.' (%s)..DOTLAST{:Uforfor-less endforFor: loop body: %s}}):$:UFor: new loop %d For: end for %d endforWrong number of words in .for substitution list %d %dno iteration variables in formissing `in' in forndforbad call to Hash_DeleteEntry ---%s ...cshksh' '%s errout=ignore=filter= Stop..OBJDIRjob table @ %s (%d) withdrew token A failure has been detected in another branch of the parallel make(%d) aborted by token %c (%d) blocked for token job pipe read: %seof on job pipe!Job_TokenWithdraw(%d): aborting %d, running %d token botch-J.MAKEFLAGS%d,%d(%d) aborting %d, deposit token %c +EI+Polling unwatched jobUnwatching unwatched jobWatching watched jobFailed to send SIGCONT to %d *** [%s] Continued Restarting stopped job pid %d. Errors reported so .END ignored.INTERRUPTJobInterrupt passing signal %d to child %d. *** %s removed%s: No matching shellNeither path nor name specifiedUnknown keyword "%s"comment=check=newline=hasErrCtl=errFlag=echoFlag=echo=quiet=name=path=Unterminated quoted string [%s].END.BEGIN%s %s --- //tmp/TMPDIR${.MAKE.JOB.PREFIX}.MAKE.JOB.PREFIX/bin*** [%s] Stopped -- signal %d *** [%s] Stopped *** [%s] Suspended Process %d (%s) stopped. Child (%d) status %x not in table?Process %d exited/stopped status %x. %s%sJobDoOutput(piperead)%sCould not fdopen %sw+Could not create temporary file %smakeXXXXXXJobStart no job slots vacant-%s%sjob startedJobExec(%s): pid %d added to jobs table exec1, 2job->outPipejob->cmdFILEdup2Cannot vfork: %s Command: localRunning %s %sly %s%s %s. Stop%s%s %s(continuing) %s%s %s(ignored) %s: ignoring stale .depend for %s @<*** couldn't touch %s: %stouch %s *** [%s] Signal %d *** [%s] Completed successfully (ignored)*** [%s] Error code %d%s Process %d [%s] exited. Jobfinish: %d [%s], status %d cd %s test -d %s && xset -%s no pidJobPassSig passing signal %d to self. R.JobCondPassSig passing signal %d to child %d. JobCondPassSig(%d) called. Cannot create pipe: %sJobSigLock: sigprocmask: %sjob %d, status %d, flags %d, pid %d Ae'\ 'csh -c "%s || exit 0" set verboseunset verbosevset -vset +vsh{ %s } || exit $? echo "%s" /opt/pkg/bin/pdkshargcmd|&;%s objPWD.%d(stdin).depend.CURDIRMACHINE.OBJDIR${.MAKEFLAGS} ${.MAKEOVERRIDES:O:u:@v@$v=${$v:Q}@}${MAKE_PRINT_VAR_ON_ERROR:@v@$v='${$v}' @} %s: stopped in %s %lx usage: %s [-BeikNnqrstWX] [-C directory] [-D variable] [-d flags] [-f makefile] [-I directory] [-J private] [-j max_jobs] [-m directory] [-T file] [-V variable] [variable=value] [target ...] ) ) failed ((: s%d error%s%s: "%s" returned non-zero status"%s" exited on a signalCouldn't read shell's output for "%s"Couldn't exec "%s"Couldn't create pipe for "%s"-csplitting: '%s' -> %d words %s == '%s', chdir(%s) == cd, done. chdircdav[%d] == %s '%s'%s: WARNING: raw arg ends in shell meta '%s' check_cwd: no obj dirs. check_cwd: empty command. check_cwd: turning check off. NOCHECKMAKECHDIRcheck_cwd: check is off. MAKEFILE-VPATHjob_pipe %d %d, maxjobs %d, tokens %d, compat %d Makefilemakefile%s: cannot open %s.%s: no system rules (%s).sys.mk.TARGETS/usr/obj%s.%s%s%sMAKEOBJDIRMAKEOBJDIRPREFIX%s: %s: %s. %s: %s. MAKEFLAGS.MAKE.PPID.MAKE.PID%u0.MAKE.LEVEL.ALLTARGETSMFLAGS.MAKEOVERRIDESMAKE .newline20090909MAKE_VERSIONi386%s: uname failed (%s). MAKESYSPATHMACHINE_ARCHsunos5make warning: %s: %s. %s/%s%sUnterminated quoted string [%s]%s %s.MAKE%s: option requires an argument -- %c illegal (null) argument.-t-s-r-q-n-m.../-k-j%s: illegal argument to -j -- must be positive integer! -i-e-d-X-V-T-S-N-J%s: internal error -- J option malformed (%s) %d,%d-I-D1%s: chdir %s: %s -B.MAKEFLAGSBC:D:I:J:NST:V:WXd:ef:ij:km:nqrst%s: illegal argument to d option -- %c Cannot open debug file %s %dstderrstdoutwa- not deferred non-existent...done: errors %d #***# full graph Make_ProcessWait: examine %s .MAIN.WAIT: add dependency %s%s -> %s bad wait dep %p %p Warning: %s%s still has %d unmade children !Make_ExpandUse: examine %s%s Graph cycles through `%s%s'MakePrintStatus: %s%s has %d unmade children `%s%s' not remade because of errors. `%s%s' was not built (made %d, flags %x, type %x)! `%s%s' is up to date. `%s%s' has .ORDER dependency against %s%s (made %d, flags %x, type %x) up-to-date out-of-date dropped %s%s already checked %s%s state %d Examining %s%s... MakeBuildChild: schedule %s%s MakeBuildChild: inspect %s%s, made %d, type %x MakeCheckOrder: Waiting for .ORDER node %s%s ?>%<*- %s%s made, schedule %s%s (made %d) - unmade children Graph cycles through %s%sGraph cycles through %s%s - centurion made %d, %d unmade cohorts - .MADE - not needed inspect parent %s%s: flags %x, type %x, made %d, unmade %d Graph cycles through centurion %s%s%s: cohort has parentsMake_Update: %s%s @ recheck(%s): current update time: %s recheck(%s): update time from %s to now MakeAddChild: need to examine %s%s non existing child...:: operator and no sources...non-existent and no sources...modified before source....EXEC node....PHONY node...! operator...not source %smade....JOIN node...library....USE node...modified %s...make_abort from line %d /..../:sh#%dinclude.CURDIR(stdin).SILENT.OBJDIR.NOPATH.MFLAGS.IGNORE.MAKE.MAKEFILESno target to make.%s: Fatal errors encountered -- cannot continue Unassociated shell command "%s"exportundefParseReadLine (%d): '%s' Unexpected end of file in for loop. Makefile read error: %sZero byte read from fileParseEOF: returning to file %s, line %d, fd %d Filename missing from "include"ParseTraditionalInclude: %s Parse_SetInput: file %s, line %d, fd %d, nextbuf %p, arg %p .PARSEFILEUnclosed %cinclude filename. '%c' expected.include filename must be delimited by '"' or '<'Cannot open %sCould not find %susing previous script for "%s" defined hereduplicate script for target "%s" ignored.MAKE.EXPORTED.MAKE.JOB.PREFIX.MAKEOVERRIDESError in source archive spec "%s"improper shell specification1003.2%POSIXMissing dependency operatorSpecial and mundane targets don't mix. Mundane ones ignoredExtra target ignoredExtra target (%s) ignoredSuffix '%s' not defined (yet)Mismatched special targetsNeed an operatorMakefile appears to contain unresolved cvs/rcs/??? merge conflicts>>>>>>======<<<<<<Error in archive specification: "%s"ParseDoDependency(%s) # ParseDoSrc: added Order dependency %s - %s .TARGETS.WAIT_%uInconsistent operator for %s# ParseLinkSrc: added child %s - %s parsing warnings being treated as errors warning: " line %d: %s%s/%s..PARSEDIR"%s: .WAIT.USEBEFORE.USE.SUFFIXES.SINGLESHELL.SHELL.RECURSIVE.PRECIOUS.POSIX.PHONY.PATH.PARALLEL.ORDER.OPTIONAL.NULL.NO_PARALLEL.NOTPARALLEL.NOTMAIN.MAKEFLAGS.MAKE.MAIN.MADE.LIBS.JOIN.INVISIBLE.INTERRUPT.INCLUDES.EXEC.END.DEFAULT.BEGIN%s %-16s: LIBRARYINCLUDEgot it #*** Suffixes: # Search Path: at end of list #*** Transformations: # From: # To: NULL (# `%s' [%d] Desired null suffix %s not defined..aSuffFindDeps (%s) No valid suffix on %s adding suffix rules not No known suffix on %s. Using .NULL suffix No transformation from %s -> %s !%using null suffix *@ applying %s -> %s to "%s" suffix is "%s"...Wildcard expanding "%s"... %s...Expanding "%s"... using existing source %s not there trying %s...-L.LIBS-I.INCLUDEStransformation %s complete deleting transformation from `%s' to `%s' defining transformation from `%s' to `%s' already there before %s(%d) inserting %s(%d)...:: aborted.PHONY .ARCHV error when made#*** Command-line Variables: #*** Global Variables: # # Files that are only sources: #*** Input graph: # %s [%s] ! : %-16s# order_succ: # order_pred: # parents: # implicit parents: # unmade # non-existent (maybe): %s # last modified %s: %s # No unmade children # %d unmade children # *** MAIN TARGET *** # # %s%s, flags %x, type %x, made %d unknown enum_made valueup-to-datemadebeing maderequesteddeferredunmade.MADE .MEMBER .LIB .NOTMAIN .INVISIBLE .JOIN .MAKE .SILENT .PRECIOUS .IGNORE .EXEC .USE .OPTIONAL %k:%M:%S %b %d, %Y %s %s%s "%s" -- target unknown..ALLTARGETSINTDONJOBERRENDBEG.CURDIR %s %d %x %x%lld.%06ld %d %s %d %sa:)}Command.TARGET.PREFIX.OODATE.MEMBER.IMPSRC.ALLSRC%s:delete %s%s %-16s = %s GlobalUndefined variable "%.*s"Variable %s is recursive.@%*!<>$(.MEMBER)$(.PREFIX)$(.ARCHIVE)$(.TARGET))}:$Unclosed substitution for %s (%c missing)Bad modifier `:%.*s' for %sUnclosed variable specification (expecting '%c') for "%s" (value "%s") modifier %cResult of :%c is "%s" Unknown modifier '%c'RE substitution errorBad conditional expression `%s' in %s?%s:%sPattern for [%s] is [%s] %d1Applying :%c to "%s" Unclosed variable specification after complex modifier (expecting '%c') for %sGot '%s' from '%.*s'%.*s QuoteMeta: [%s] \ Modifier pattern: "%s" Unexpected regex errorNo match for subexpression %sNo subexpression %s%s: %sVarMatch [%s] [%s] Var_Append("%s", "%s", ...) name expands to empty string - ignored %u.MAKE.LEVEL.MAKEOVERRIDES%s:%s = %s ignored! Var_Set("%s", "%s", ...) name expands to empty string - ignored .MAKE.EXPORTED${.MAKE.EXPORTED:O:u}${%s} (not found)%s:%s = %s @*?%<!.ARCHIVE>%s: %s. depth_sigpause < 2depth_sigblock < 2/tmp/pkgsrc/wrk/devel/bmake/work/bmake/sigcompat.cdepth_sigsetmask < 2444 55*5:5J5Z5j5z555555555 66*6:6J6Z6j6z666666666 77*7:7J7Z7j7z777777777 88*8:8J8Z8j8z888888888 99*9:9J9Z9j9z999999999 ::*:::J:Z:j:z::::::::: ;;*;:;J;Z;j;e  " L  oo$1oPt1T1po`od;|($ xt#xt#pxt#l #${VPATH}/opt/pkg/share/mk @@|tl` TD 4 ,             d`anotate anotate0 ,(;;<anotate<<AAu$E1XGxI(JJ@K4LzLMMM| Aanotate AAanotate`hNXHhN>NrO8OLO<O8 OanotateTO! <O5OPxVY [anotateH D@WxVXpXPYxV'ZOMZOsZOZOanotate[r[E,\ <\]E(^$L^,x^l^/_DX_dXhiimmgnhlnXofo+rS@s `dckpjlkllVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV'VI<|`cBllcth6jKjDk kkYlanotate Y^(^`cc`c`c`c` c`$c`(c`,c`0c`4c/a8c`\Fanotate w\w\w#w`w>wdw>whw>wlw>wpw>wtw>wxw>w|w>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww#ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>ww>wx>wx>wx>w x>wx>wx>wx>wx>w x-w$x>w(x*w,x>w0x>w4x>w8x>ww@x>wDx>wHx>wLx>wPx>wTx>wXx>w\x>w`x>wdx>whx>wlx>wpx>wtx>wxx>w|x>wx>wx>wx>wx>wx>wx>wx>wx>wx8wx>wx5w}{vۊvW anotateh `h6SwloܔfD=D@ t}anotate danotate`[xmܛlHd> C_kanotate\p8(pOHdX   ,D\<^ -̬R -PvȱCĶķl`A$)Ph rpdd@zdn6)tD:0E  B={anotate \vι J,DDD\S\\X anotatexM+,  Ql$ HmR eDzpb`H.`8-Dde H (?, 'qGVuK!w+K! vgXI:+  :anotate( $ z ~$(~,~04~8~<~@~D~H~L~P~T~X~\~`~d~h~l~p~t~x~|~~~~~~~~~xl`%~~~ ~~~~~BPFFFFFFF FFFFF F$F(F,F0F4F8F<F@kDBHLLFPFTFXF\`dFhFlFptFxF|FFFfFFFFFFFFFFFFF\O2FFF`Hlanotate|`^`ZkT]/hfh | )L$2$U|;pN s  anotate yn  h | 5qL|s]-h >hjT canotate<*t&cL_do, "34"P"t.4/,22,23l|5\6$779 :+;@@SLALEZEELFh" L-l)L-rrrr7r'rrrrrrrrGrrrrrr_l(-K#W?ch#.m4mUUmUUUUU%UUUUUUUU$L-d-d.`_9: 5w5%6699:GEanotate   !#.%t((-(P")L-!*4"B,"L-E*P-E*T-E*X-E*\- *`-E*d-)h-E*l-E*p-E*t-E*x-E*|-E*-)-)-E*-E*-*-E*-E*-E*-E*-E*-E*-2*-\)-\)-\)-)-\)-\)-\)-\)-\)-\)-\)-\)-\)-\)-\)-\)-\)-(-\)-(.%).\). ) .\).1).f$.-$.f$ .N%$.N%(.f$,.N%0.N%4.$8.N%<.N%@.N%D.$H.N%L.N%P.$T.N%X.$\.N%`.N%d.N%h.N%l.N%p.$AR#A2iD,2anotate$lF<lFXJPJKLjFlIGI                                   I LanotateP LHGIIHIHIHIHIHIHIHIHIHIHIHIHIHIHIHIHIHIHJHJHJH JHJHJHJHJH JH$JH(JH,JH0JH4JH8JH<<+G8].anotate anotate anotatel% l%anotate% %anotate anotate anotate anotateA Aanotate0D D{ anotate$ Danotate4 4anotate( (anotate$T Tanotate8 8anotateL( L(anotate$t tanotate@/ @/anotatep panotate ) )anotate8 8anotateT Tanotatel) l)anotate] ]anotate4 4anotate, ,anotate anotate anotate anotateL$<$"H*tspZ@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)ar.h 1.10 93/11/01 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)param.h 1.82 06/01/30 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)dirent.h 1.37 04/09/28 SMI@(#)dirent.h 1.36 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)assert.h 1.10 04/05/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)file.h 1.70 07/03/05 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.25 04/07/19 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)mutex.h 1.21 07/04/04 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.14 04/10/21 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)poll.h 1.7 92/07/14 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)socket.h 1.78 08/01/18 SMI@(#)uio.h 1.33 08/12/22 SMI@(#)socket_impl.h 1.1 05/08/02 SMI@(#)un.h 1.11 02/10/02 SMI@(#)if_dl.h 1.10 03/05/21 SMI@(#)netconfig.h 1.24 04/02/27 SMI@(#)in.h 1.54 08/01/04 SMI@(#)stream.h 1.115 08/07/22 SMI@(#)vnode.h 1.129 08/06/19 SMI@(#)rwstlock.h 1.4 04/11/09 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.27 06/05/03 SMI@(#)seg_enum.h 1.8 05/05/17 SMI@(#)kstat.h 1.22 07/02/02 SMI@(#)kmem.h 1.37 06/03/10 SMI@(#)vmem.h 1.12 05/06/27 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.24 04/09/28 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.18 04/09/28 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)stat.h 1.11 04/09/28 SMI@(#)stat_impl.h 1.4 03/12/04 SMI@(#)utsname.h 1.30 04/09/28 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)uio.h 1.33 08/12/22 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.17 06/03/10 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)fcntl.h 1.52 07/03/05 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)time.h 2.76 05/06/14 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)param.h 1.82 06/01/30 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)regex.h 1.25 04/09/28 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)param.h 1.82 06/01/30 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)wait.h 1.23 04/06/03 SMI@(#)resource.h 1.37 07/02/07 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stddef.h 1.18 04/09/28 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stddef_iso.h 1.2 03/03/06 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)param.h 1.82 06/01/30 SMI@(#)types.h 1.86 07/09/20 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)signal.h 1.43 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)unistd.h 1.76 06/03/10 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)param.h 1.82 06/01/30 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.493.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.shstrtab o4  L L @!""")o$1$107 BT1T1A B\1\1J Bt1t1P N44S;;JY_e m1v{;hhd!d!Eh!h!od!;$] %070701708d9b89000081ed0000000000000000000000014ad9c41d000019db000001220000021fffffffffffffffff0000001c00000000root/opt/pkg/bin/install-sh#!/bin/sh # # $NetBSD: install-sh.in,v 1.4 2007/07/12 18:32:50 jlam Exp $ # This script now also installs multiple files, but might choke on installing # multiple files with spaces in the file names. # # install - install a program, script, or datafile # This comes from X11R5 (mit/util/scripts/install.sh). # # Copyright 1991 by the Massachusetts Institute of Technology # # Permission to use, copy, modify, distribute, and sell this software and its # documentation for any purpose is hereby granted without fee, provided that # the above copyright notice appear in all copies and that both that # copyright notice and this permission notice appear in supporting # documentation, and that the name of M.I.T. not be used in advertising or # publicity pertaining to distribution of the software without specific, # written prior permission. M.I.T. makes no representations about the # suitability of this software for any purpose. It is provided "as is" # without express or implied warranty. # # Calling this script install-sh is preferred over install.sh, to prevent # `make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit="${DOITPROG-}" # put in absolute paths if you don't have them in your path; or use env. vars. awkprog="${AWKPROG-awk}" mvprog="${MVPROG-mv}" cpprog="${CPPROG-cp}" chmodprog="${CHMODPROG-chmod}" chownprog="${CHOWNPROG-chown}" chgrpprog="${CHGRPPROG-chgrp}" stripprog="${STRIPPROG-strip}" rmprog="${RMPROG-rm}" mkdirprog="${MKDIRPROG-mkdir}" instcmd="$mvprog" pathcompchmodcmd="$chmodprog 755" chmodcmd="$chmodprog 755" chowncmd="" chgrpcmd="" stripcmd="" stripflags="" rmcmd="$rmprog -f" mvcmd="$mvprog" src="" msrc="" dst="" dir_arg="" suffix="" suffixfmt="" while [ x"$1" != x ]; do case $1 in -b) suffix=".old" shift continue;; -B) suffixfmt="$2" shift shift continue;; -c) instcmd="$cpprog" shift continue;; -d) dir_arg=true shift continue;; -m) chmodcmd="$chmodprog $2" shift shift continue;; -o) chowncmd="$chownprog $2" shift shift continue;; -g) chgrpcmd="$chgrpprog $2" shift shift continue;; -s) stripcmd="$stripprog" shift continue;; -S) stripcmd="$stripprog" stripflags="-S $2 $stripflags" shift shift continue;; *) if [ x"$msrc" = x ] then msrc="$dst" else msrc="$msrc $dst" fi src="$dst" dst="$1" shift continue;; esac done if [ x"$dir_arg" = x ] then dstisfile="" if [ ! -d "$dst" ] then if [ x"$msrc" = x"$src" ] then dstisfile=true else echo "install: destination is not a directory" exit 1 fi fi else msrc="$msrc $dst" fi if [ x"$msrc" = x ] then echo "install: no destination specified" exit 1 fi for srcarg in $msrc; do if [ x"$dir_arg" != x ]; then dstarg="$srcarg" else dstarg="$dst" # Waiting for this to be detected by the "$instcmd $srcarg $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if [ -f "$srcarg" ] then doinst="$instcmd" elif [ -d "$srcarg" ] then echo "install: $srcarg: not a regular file" exit 1 elif [ "$srcarg" = "/dev/null" ] then doinst="$cpprog" else echo "install: $srcarg does not exist" exit 1 fi # If destination is a directory, append the input filename; if your system # does not like double slashes in filenames, you may need to add some logic if [ -d "$dstarg" ] then dstarg="$dstarg"/`basename "$srcarg"` fi fi ## this sed command emulates the dirname command dstdir=`echo "$dstarg" | sed -e 's,[^/]*$,,;s,/$,,;s,^$,.,'` # Make sure that the destination directory exists. # this part is taken from Noah Friedman's mkinstalldirs script # Skip lots of stat calls in the usual case. if [ ! -d "$dstdir" ]; then defaultIFS=' ' IFS="${IFS-${defaultIFS}}" oIFS="${IFS}" # Some sh's can't handle IFS=/ for some reason. IFS='%' set - `echo ${dstdir} | sed -e 's@/@%@g' -e 's@^%@/@'` IFS="${oIFS}" pathcomp='' while [ $# -ne 0 ] ; do pathcomp="${pathcomp}${1}" shift if [ ! -d "${pathcomp}" ] ; then $doit $mkdirprog "${pathcomp}" if [ x"$chowncmd" != x ]; then $doit $chowncmd "${pathcomp}"; else true ; fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd "${pathcomp}"; else true ; fi && if [ x"$pathcompchmodcmd" != x ]; then $doit $pathcompchmodcmd "${pathcomp}"; else true ; fi else true fi pathcomp="${pathcomp}/" done fi if [ x"$dir_arg" != x ] then if [ -d "$dstarg" ]; then true else $doit $mkdirprog "$dstarg" && if [ x"$chowncmd" != x ]; then $doit $chowncmd "$dstarg"; else true ; fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd "$dstarg"; else true ; fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd "$dstarg"; else true ; fi fi else if [ x"$dstisfile" = x ] then file=$srcarg else file=$dst fi dstfile=`basename "$file"` dstfinal="$dstdir/$dstfile" # Make a temp file name in the proper directory. dsttmp=$dstdir/#inst.$$# # Make a backup file name in the proper directory. case x$suffixfmt in *%*) suffix=`echo x | $awkprog -v bname="$dstfinal" -v fmt="$suffixfmt" ' { cnt = 0; do { sfx = sprintf(fmt, cnt++); name = bname sfx; } while (system("test -f " name) == 0); print sfx; }' -`;; x) ;; *) suffix="$suffixfmt";; esac dstbackup="$dstfinal$suffix" # Move or copy the file name to the temp name $doit $doinst $srcarg "$dsttmp" && trap "rm -f ${dsttmp}" 0 && # and set any options; do chmod last to preserve setuid bits # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $instcmd $src $dsttmp" command. if [ x"$chowncmd" != x ]; then $doit $chowncmd "$dsttmp"; else true;fi && if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd "$dsttmp"; else true;fi && if [ x"$stripcmd" != x ]; then $doit $stripcmd $stripflags "$dsttmp"; else true;fi && if [ x"$chmodcmd" != x ]; then $doit $chmodcmd "$dsttmp"; else true;fi && # Now rename the file to the real destination. if [ x"$suffix" != x ] && [ -f "$dstfinal" ] then $doit $mvcmd "$dstfinal" "$dstbackup" else $doit $rmcmd -f "$dstfinal" fi && $doit $mvcmd "$dsttmp" "$dstfinal" fi done && exit 0 0707015afdc855000081ed0000000000000000000000014ad9c4760002046c000001220000021fffffffffffffffff0000001600000000root/opt/pkg/bin/nawkELF344 (44o </usr/lib/ld.so.1gh !#$%&'(*,-034689;<=>@ACHKLMOQUVZ[]`abdhijklmoprsuvwyz{}~    !"%(+-.12345678:<>@ABCDFGIJKNRTVZ[]abdfg  ")+./1257:?BDEFGIJNPRSTWXY\^_cefgnqtx|  #$&')*,/09;=?EHLMOPQSUWXY\^_`ce F  (%a  .061;2AI Sj ]gyL) xN <[o $  D* p0 u / p 426 [ ul `| Pq x ̷/&,] . 6@h ?# G$3Oi VY ` i̢ps w0 }< 0hf 214  t XX ,15 \ XS DD1 3 p!  %2-43, ;Bԏ J2P W0 ^8bl u }.  k (  s /Z  T2@(44# j 0R  o   D)  x" !% %a ,Č% 1hP7+ ;ȦJ0QK X ^t\ bn1v~l(i g t2/Hpqi  d0\- T1,t  n  w 8t03, + ̿e ؋" "%0,% 2$% 8L+ >{K D40N T+ _d1f41m0vh{T.  @51D34 4 4{ d /0G H  V<p d3<ȳP  .13d/=(B0G O X2`WT in8L px u# |`k P ܞ lq" ps /O /ij( ķ l dk  Ȣ0 4_ 'e -2$a 9`  W D0I0S$V\foT0t% D2 4tT y( 3   = (   8 12| =L p,1 2@8X ! + (1007p?<F L Ut1\1ckuH@ z JT3 T/   h" `L@   0 (   3 /. 0 hXh i $#)H 3_ :D/AY JT3R$Y Z]Тf$0n2rp L zĢlT /_,2"43&2, $i  xj)    = lt/   d2ȺX ! $_8) d$10 8 ȷA a H L  T D0[ # b tq _ z Ld -o  Ħ d \ t3 0H ! h $2! Z jumpfieldadrrecinitpatbegRSTARTcclenterstrchrsrandfputscmdnamecursourcesetsymtabpairstack__longdouble_usedsetfvalWARNINGmkdfanode1getnfnode2node3isblankclosefilereparsesqrtnode4makesymtabstartregrelexhexstrfilessafe___Argvgettoklastfldfunnyvar_endvfprintfmatchopexecuteredirectstdinitislowerdostatawkprintfindirectendlocconcatarrayyylexmemcpyipowsscanflen_inputFSyywrapnfieldsunarystrnodepatlensystemrehashfreefacheckdupTrueabortbrackcntgetsvalisgraph_environsetclvarinitgetrecisalnumjnextgettempnpfilesyminitatan2intestrecbldORSerrorflagfpecatchreadrec_etextdonefldparencnt_finiFATALlinenowordexptostatstrcmpbclassnframelogenvyyparsepaircntpmatchrecsizecopycellgetargvassignrectonodeforstatop1op2ifstatop3nfatabop4static_inputFSstrlenpastatsplitaltcharclasseslongjmpARGVtabbinsearchpa2stattoupper_exitwinnerprimaryOFSinput__flsbufbacksubnematchformatsetsvaljcontfopenisdigit_lib_version__iobjexitregexprisclvarstat1scstrcpystat2stat3stat4cgotosetlocalepgetccelltonodestrtodfflush__assertARGCENVtabunputstrenvinitrstartloccurpfiletmpset_DYNAMICispunctis_numberrlxvaldonerec__fsroverfloreallocfclosefieldssizegsubyylvalSYNTAXrelopisupperarithcompile_time__fpstartjretmodf__ctypeincrdecriscntrlsetfnametmpsisargqstringerrchecklookupcurfnamegetpssvalregexpmakearrnodeallocfsloccallocfnrlocrefldbld_edatanullnodeflush_all__1cG__CrunMdo_exit_code6F_v_infuncFNRarglistpentercfollrtokquotedgrowfldtabatofjnextfileNFnflocmaxsetvecliteral0atoipeekmakefieldsinstatarginittoknameCONVFMTcleanfldfreesymtabyyerrornullprocstrcatpclosebracecheckbracecntawkdeleteebuffwritefreeelemisalphaFalseconstnodeboolopstrncpyrecordproctabjbreakitonpopenfilesetjmpungetcyynerrssymtablocmaingetline_PROCEDURE_LINKAGE_TABLE_closealleprunyyinlinkumptoitfreeawksprintfdefncallSUBSEPkeywordseprint_startmalloc_init__filbufnotnullfollowRLENGTHargnoprintstatfreetryychartostringisspacemakedfafpbeginlocstrncmpcosgetfval_GLOBAL_OFFSET_TABLE_inlooprlengthloccondexpratexiterrno_get_exit_frame_monitorisprintpopen__fsr_init_valuewhilestatmemberadjbufsindexOFMTdopa2tolowercurnodeyysptrlexprogFILENAMEnewflddbgbcheck2signalsubstr__environ_lockfilenameyysbufunputnulllocinfilebltinmakeinitisxdigitfirstsinprogramlibm.so.2SUNW_1.2libc.so.1SUNW_0.7SUNWprivate_1.1  '=  (= qN :H8} *^&ĠȠs̠0РԠVؠܠ"3  PB  $x(,0748<@=DNH1LePTXa\J`|d h>lp5t;xI|E+<,`5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%ĠhP@%ȠhX0%̠h` %Рhh%Ԡhp%ؠhx%ܠh%h%h%h%h%h%h%hp%h`%hP%h@%h0% h %h%h%h%h% h%$h%(h%,h %0h(%4h0%8h8p%<h@`%@hHP%DhP@%HhX0%Lh` %Phh%Thp%Xhx%\h%`h%dh%hh%lh%ph%th%xhp%|h`%hP%h@%h0%h %h%h%h%h%hjjRth.tt PEpu TpRU RPf;PP^jwURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]UÐUÐUSVW3D3һ0,8 Dž(Dž80f9,D +(C'vȁ'H#' kPȉ$2:+ 3‹+;#©t{ Ã(}33|BC,3fffBfAfBfAfBfA;,~;({ffG;(~d Åw33r>C,3fffBfAfBfAfBfA;,r;sffG;r$‰( , |&+ƙ3‹+;#©uY(Åw33҃r0C3ҋ>9~y~y~ y ;r;B;rK(Ӆ}3҃|,3ҋ>8~x~x~ x ;~;HB;~7(,ۉ 8( ;t Qj \(,D(DA,;0Vx =Du DDED3?0?@T~Tw=]v  y~=wy0;um@Ti`ى a'D((HtH00{  }0(+щ$ 4=;$T (pC4(0hL0R4 (0&UPh!R4j(0R4(0pj(0QRP(psS4\j(0R4734%(0h\@Q4j(0QPh\Q4 (pQ (qPh Q4j(pphRQ4x(ppphRP4Q (p0tD (p8jP(qqPjqP 4 (pppjp}P 4j(p(qqPjqBP 4 (potL (pwjP8NP P(pWjpO 4,#P P(ppjpO 4j(pO P(pWjpnO 4j(0zO4(ppN4z (pOhOjP(phSN 4= (pTOj(phPPW(phSN 4 (pOhO(qPqhS`N 4j(0lN4 (pmtC (pujP6P(pjh0M43(ppjh0M4 j(pP(pjh0]M4(@4 hx (pph.L4(pph.L4djjjhQL4Fjj(0hQL4" (pUO(1PjhQuL4 (pO(1PqhQ=L4(phFK4(phHK4k(0hGK4H(0hIcK4%(0h$@K4j(pK (qPhM,K4j(pK jPhMJ4 (0M{KPWh"J4b (pM (qPh"J4, (p_M KPWh"VJ4 (0PhXJ4(4(0hWI4(0phYI4l(0ph7I4F(0ph6I4 (0ph5\I4(0ph46I4(0ph3I4(0ph=H4(0pyJ4gDž4X Ģ(0phUG4,Ģ!jhTG4(phT~G4 =Ȣt hsjh2HG4 =Ȣt hdsjh1G4t (@4` j(0ph-%G4; (0pph-F4 jh(F4 (ph(rF4 (p P(ph'`F4 Ģ Ģ =Ģu hBrjh%E4R =Ģu h( rjh#E4 D hHq (0D4 (0F jPh&sE4 (pF (qPh&=E4{ jj(0pCE4Y =t h\q; (pnH(1PqqD4 =t hpp (pH(1PqqD4 =t hkp (pG(1PqqGD4] (@4I ? (0OPhXQD4 Ej(0PWjh eD4 (@4 D4 (0pE4 (0pE4u (0pfE4T (0phVC4. =t hn (pCF(qPjhQbC4=t hn (pE(qP1hQ C4 (0C P(phDB4M (0eC P(phDzB4 (0 t@ (0jPP(pjpKB4(0pjp(B4j(0hP(pjpA4g(0ppA4C(0ppA4(0pp]A4(0pp9A4(0ppA4(0pp@4 (p (0 PWh@4O (p^ (0L PWhq@4 (p (1qPhEa@4(0pp@4(0phV?4 (0@ P(phD?4X (0p@ P(phD?4# (0 t@ (0 jP P(pjpV?4(0pjp3?4j(0s P(pjp>4r (p (0o PWh>42 (pA (0/ PWhT>4 (p (1qPhED>4(0pp=4(0p?4u(0pf?4T Ȣ(pppq?Dž4Ȣ(p5̢>̢Dž4(p5Т>ТDž4(pjhP<4(ppp>4i`=jPh@< P(0p=42(pph;4 =jPh@; P(0h;4 (04(@4Dž4Dž4Dž4sDž4d (ps4E (0- (0 Ģ (p&<(1Pqh :4Ģ Ģ (0pjph): 4Ģ Ģ (p(1qPqh)a: 4RĢJDf he)=u 5̢75Тh9H0+؋4$A } w‹(=w 0;t Vz0@T0u-=DhHDt#G=w?0u ?BTH; d(0/PR(0Vx덃((H0Dž({ H0;+ÃB;s3҃ XV/PVG/PVG/PeVG/PJ;s;0r+V/P!;0s38 ;t QÍe_^[ h| c hd c먐HRHRRQHRHRHRHRHRHRHRHRHRHRQQQ|QqQ3QQQPHRHRHRHRPHRPHRPHRPPvP=PPOOOfO8O-ONHRNHRNNVNNMM%MLLLHRHRqL9LKKKqKMK)KKJJ0JIIpIIHHRHRHHHRHHHRmHHRHRHRHRHRHRHRHR5H HGGHRHRGCGFFFiFKF,FHRHREEEEtEPE3EHR EDDDhDDD'DHRDCCHRCHRHRCtCNC(CCBBBBTBBAA~AFA#AA@@@]@&@@???u?;?>>\> >===I=<}<;;;HRHRt;F;#;;:::V:3::US]Cu t(sh`shD_Ce[UE8t3 @xÐUE@@ÐUEP w$XXu5ķPh3ÑXXXXXXXXXUSV]E pt4CpVt [uu Ee^[^]e^[USVW=8uR jXW8 P>@=8tu h؅l =~khu MM3 9!uu tG;|*H  h!hE%u u"E h!y}l3۸3|V:!;}@z!;}@z!;}@z !;}؃@;~;E !;}؃@;E~ 4h(M hP!9h Q!ME E Me_^[ Ee_^[USVW u jjh61 jPh&1 SPhV1 jjh 1 PShV03ۉ Vwk (!Pju hą H!VW V$!Pj u hjj u h ] SW. !! u`B Ǎe_^[ÐUSVWudž!Ɔb 3ɉ!$! ;t Pdž {Pj u h }3ɋ33Ƀ|qKM33ɋ$!?<B$!Ћ $!Ћ $!Ћ P ;M~;u$!?<A ;~M!9PuƁb 3ɋBBBBBB~BhjuM!} S 3}3|p]3 ؋  ؋  ؋  ؋ ;u~;] ȋ F;~Mb ` !t !e_^[ÐUS]C v =Vt W$_ ssCXCX# sCX e[ÃPhhOZ琐___________US]C v =Vt [$` ss]e[w s]e[\]e[Oe[ÃPh@Y琐X`X`X`X`X`X``=`=`=`USVE3ɩtQu"svswDDDAB}ƀuM^[USVW];}WUtnt~ftrrtfbtZ\tvxt?pЃwiOMЃw$MPBEOQЃwt@E2 EP!   M e_^[ÐUSVW,EE܉Eu! 5ЉKUE@E3\n-wOMԅh]@E\u EPȋ}9MAEЋE;^+E9E~3ۃM؃jEPjd+Whh] ]CEMQUjURjd+ȃQhh] kC]ԋE}G};]t;]jEPjd+Whh6] 0MAMԋE}G};M~_O}NX EP`؋}jEPjd+Whh\ E}G}FE@E=t5uhE܅t P] 5:e_^[ÃuhUuhkUSuhSU}uh;Uuh#U UuhdTÐUSVW] C v =Vt $gsu[ɋ[ċ k u!Kk  ! 8!;|wPQQ 8Q5@1 8@t t hL 8!;}|Suu!+ƃ+; 8+8+; ƅu"E33 8F;!~TE䋰!3҅|E8N}3Ƀ|$N38xxx xx;~;B;~3 S @Pju h(k M$!!8y}3|S<u 8I|u 8I|u 8I|u 8I}|<u 8I}] e_^[ÉE Ee_^[*R[e[e[e[e[e[e@eVeVeVeUSV]C vB=V st ^ sC$i ssȅ  s[3 sF 89};PQ 8Q5@ 8@tt ! h 8;};{<t Ex t @8e^[ÃPhMPᐐhhhhhhnhhhhUSV]{ tcsF =t=t=u;=u S$=Vu&;^t vu ށ~ u]e^[ÐUU tMB;t u3ÐUSVW} E!u !jP]3` ur}=| hhhE i tPVS3` uEx8u3 e_^[ÐUSVWE EE!u !jPE !E(,]E؍ E܋E䀼;` t +M ,=|hhh i tPWSt)F>u;` t +EH,=,|=,!d!|.}ܾt Q!F;~ڋ 0FPj  u hN3}3Ƀ|pNM3ɋ Ћ  Ћ  Ћ  Ћ ;M~; Ћ A;~! !` b 3M؋BBBBBJ=~BEHM8E(3 E(e_^[ÐUSVWE EE!u !jP[E !,E8\]E؍ E܋M䀼;` t +E,=|h/hh@ i tPWS& t*N>u;` t +MI ,=,~=,!d!|.}ܾt QZ!F;~ڋ 0FPjJ u h|PN3}3Ƀ|pNM3ɋ Ћ  Ћ  Ћ  Ћ ;M~; Ћ A;~! !` b 3M؋BBBBBJ=~BE@E8E(E(3e_^[ÐUS=tuhlEtJ؃=u jjh\؋Íe[Ã55h@HڐU PyPÐUS𡜯$u,jjhP((uv)t/؃=) S h<, PjhbP^u8O h% Pjh%PpM=u,jjhP==u,jjhP =u> 5 Pjh S=u; 5 PjhDB S`=u; 54 Pjh S>55h 9|kRQ莱 8QPs 8@t t h؁H 8<u 8GE;8_E@EЋu; @E!8q}3|o<t@É8I|t@É8I|t@É8I|t@É8I}|<t@É8I}M!E~v@ EMM܋E iEE;u"~/Mؾ899u F;~E@E;E~M܋UԋEEE!ǀ! 3t P!3Ct P sCt PsC t Ps ~t PG~ߋE! @M!U3ɍ iA! iA! iA! iA! iA! iA!~ui! t P!DŽ @Pj؅u h! !uM i@ |r4+3+}@+@+; ljEฬ++; Nj}#9uu 33ɋ@A; ~M3|GA}3|*A:;z{z{z { ;~;F;~M!8<!ш` !EEe_^[ÐUSVW }!3ۅ|, t P !C;~ڋu3!|S!Ct PCw{t s辫C G;!~] t P蒫ǃ ]e_^[ve_^[USVWu] hLj˫hHj輫hj誫` j2<E]{8-xhPҪA0$Ĉ5h軪jAe AP  t Qhq%Qh4yN ߋEp: Ep%Au.N߃~>Gttt/xtE"ĆEtuytEĆEE8ujN߃=H O ȳ2hQHuQhp3NN߃=u_~1=uO&=uD= h\3=tshبN 5=tPVhD苨SV: =u 5p, (h@j蝨EtjP =t5h0=t$1 5H9] ue_^[à hW2w h܆1 hȆ15hhȯjhj` j2 <E j軦"օ;;{nUS` u`; h,4ȳu `%h(4ȳ脦`t{I`yL PiuN`;t P_  `A 3DHQPe[á4ȳh|/`_U=3 ȳUS EPǤ؅tCCÍe[à h /אUEÐU jMH M HU jiMH M HMHÐU j=MH M HMHMHU j MH M HMHMHMHÐUu u1ÐUuu u.ÐUuuu u2ÐU uuuu u4 ÐUu uÐUuu uÐUuuu uÐU uuuu u ÐUME AQjÐUj5Ph\ ÐUSV];uZsF u:uFFt PF j2FFvhA*Íe^[ÐUS 5Puu uh ءH 2|j2h܇)Íe[ÐU=u/Et#} t%Pt J‹хuM HEE EUS]Cux suNC ECE 3ɅtA@uMEEX =tH@ME Ede[CE Ee[(CE Ee[(e[USVW =33;t#]SGp`tFuƍe_^[UEUEUM[w QhhݠU5<jjjlPP 5<jjjh\h` jPķ5<jjjhThXQ  5<jjjhLhP# ,5<jjjhTh 45<jjjhLh 85<jjjh<hD l5<jjjh<h  5<jjjh,h0V ȷ5<jjjh$h(-  $5<jjjhh  ij (5<jjjhh  05<jjjh h 5<jjjhhz  5<jjjhhL  $5<jjjhh  <HÐUSVW\5<j]E$hh h5<jjjh؍h܍j2Fs} 3ۃShԍEPo7,u5jjj7EPH 4 7E]E5j$7EP C;~e_^[ÐUSVWu5<jjjhЍhj2Cj=P远؅ti;te{ W,u5jjjW6i 0 Wg]E5j$W67 =vue_^[ÐUSVW j j]Stt_wǍe_^[à h&%ؐUSVWMAY{3EECE0tVF3t Pl~FuFt PK~~ V9 uCEEE@E;C|;u% s]e_^[e_^[ÃEph$USVWE@Epu EMA0} 3ۃvW蓙t Fދu[tFCNE@EFuFt P:F v%VEe_^[USVEt`uP9؅tK=CuLKuLsC $QPShT՘ j胘؅ uCE t P h$CE[ ECCM@Q4;~ QEPRuiMQЋSA=t%sC $ssSh Íe^[Ãuh("US]3 3;tkC uM ;r3‰][ÐUSVWEE@E؃jPb؅tvEHP~Q3EEE܋<t,wuwe OQh(MFuh uh2USV@]SEh̒Pd5jjjEhPKPZ=tVShaƍe^[ÐUSVE8=t@8=uj@P5<jjjVuVSsNt s輄[ K=tVuhǃe^[ÐUSVW,=5Au Qeq V裃;~At P$ CP=M3ۅt xE 3EM t t uF t t tEC; SM܋Ju4M@t' PBE@E܋zE܋@FFG t t tuEG+> ,0E v3EظEC; S6M܋ Au/At( PaE܋ ȋ AyE܋@F;Et;EttFG;Et ;Etu3GEF;O>EC; SlM Au$At P藀E@EE EPMыB@BAEF>b5Vw;5CP~QƋ sOu s赀[ KG;~]Eԃ$5ء=t53ۃ=|*30ppSh}C;~؍e_^[ÃSh\{  Vh(e USVWuM ;+@;~3AEË8GuGt P~G GFË8GuGt Pm~G GF;u~;u DE EË8GuGt P"~G GFF;u~e_^[US]E];~ SS@P E$5B؍e[ÐUS]|";~ S&e[ÃShːUS ɋ+UH#‹+؍C %?H;t!t3 P }Q5,}uShĐ*S@P3e[USVW] S|;5~At Py| FPP|5=;u 3Eju 蕥E܃=tu Sht5|E܋ !EEE; Pz 0Au,At% P{Ƌ@ƋAFƋx=tuh{Su轹toEǀ !(=t5,Ph\K{(+PSWf|(+ÍL(,E=tShLzSW{E܋M !]Ee_^[ÃVh4USVW=W 0MEE$. 06VzMh@UR5D+0Phh0 MMFtAEAMFu}E$vw 40yMhUR5D+0Phh0q m4MMBtAEAMBuG}E$hEP50+ 0QhP  E=t05hďxAu(At! Px@A0  A=t<05hďpx=t50hQxe_^[Ã50h Q50h 6x50hUuhÐUS A~e[Ã5hȯSx E PuSx 5hSw=t5hSw=u tPhSwhSw<LUuhtÐU Au_4tHv PtHwj}j{5) j]j[5 j)j(5UEt[>t}fuPhphȯvLEEE DEȯvuPhPhȯyvEEE dEȯZvUS hw 5hȯS(v E PuSvt= j ue[vUS hv 5hȯSu E PuSlve[ÐUShȯSu=( 0<$$ fD$l$\$,$D$Ph,Suh(ȷ0bttȷ0hSthSt=tm=$t$phSt =t5hSt=u tPhS_thSNte[USVW 𡠣H hXHp;v- uKH;v ttK;v t u uC; thhȯshx;r*@ t! t tO;r t t uw;+;v3;t5ȯHȯx ̯A̯hȯP t{t7ȯHȯx ̯A̯ChȯCPs;v;w?;t5ȯHȯx ̯A̯hȯPsC;vhȯVrh;sE;t;ȯHȯx ̯A̯hVP+shC;rhȯVrh8uȯgnءȯ tVtRtMHȯx̯H ̯ VSr S]nءȯ t tuHȯx̯H ̯ hȯj frphe_^[ÐUS U(uA&)uI[u@]uH{uC}uK [ÐUE!t1"t ]EuhuhȎ뱐USUu_u:tu<_uBu<=u;v z=33U[ÐU3EPuq]E蛋M;MtQD@t;="t2 t t uAM t t t3USVW u} ;7MuEt[M+'ƅx;|‹]t2U+څt+VRnt3M7ËM.t+V]3nt7 Eu3ue_^[ÃPh,UA u jEUSV]$;C Z 8PCPуF@t =tt=u ;tl>tgCt`~u VC$؃8tfsF@t =tt=u 5Dƍe^[à hTC )USV h@n]t; P~t>~u V D{u{tajhh0d~F EpGHt,u Pyjhh0 h@muBE@t8 PCtBt=t8t3{u SDe^[à h h뻐USVW ]3hDH @ (= u-djPOk C3Ʌ$t $@uD@ <$$ fD$l$\$,$T$<=t6 + QR$ h0j <$;|<$2Ep3H8@=t*+ QSh4j V88=tHOuGuWu 4PRG $QShi G t @8 W@u W8@Cvݝ( 4v4qP݅($ hpe 4e_^[ÃQhr h\WPQ hjj2P h؛"d whpG hLUSVOCuFCFt vCF [ F%3CÍe^[ÐUS E0؃=t0Sh&dK;@e[Ã@pQhUSE =#u <=%u 8=(uzEt] PhS!]E<$$ fD$l$\$,$D${u Sc jh@d2=1u 4=2u0=TE P؋Cȃt_u9 SO]E $p d SqPp E SRPp yS]E@ X @ H{u S? (e[ÃPh7ЃPh$3ҐUSVW,𡼦E PaE h c\ u~' vbv-E܃|uE܃ SMPuM4E܀{u Sd }EuPEP؅t5 PuV~ V u0p pwa]EЛX Hha>tCEjPEP76#uVa~u' VO jhh0؃]EЃ$Wo؃ u_Ǎe_^[à hh U=uEÐUSVW,𡼦E 0_E܃ u@_E ]3-EԋEs V E؃ PuY_WN_jj5]܍DPEPEP M7WQ`~t0uy`E؀xu PvXMԋAux=t#AuPhv^Eԋ@ȃu#MԋIt Q ^E@@MԉA j2MԉAEpjjjhu CEԀxu P u]Íe_^[à hPEQEph4MUSVW, 0]E܃ ]32Eԋ@L{E P\E0Es VE؃ Pu']W]jj5]܍DPEPEP MWQb^~t0uG^E؀xu PvXuufu+\0 uSMԋAA j2MԉAEԀxu P(DDe_^[à hQEphԙM USVW,𡼦E 0[E܃ ]sYEԋHun=tphg[EԋHu#Eԋ@t P[E@HEԉH j2ǿMԉA uZE E3 VE؃ PuZWZjj5]܍DPEPEPo MWQ/\E؀xu P~ދst0u[sUEpuE؋EԀxu P* uYtD@e_^[à hQEphԙM0USVWju 3ہ0Eu dkE }wDE܃ PIE?tC wW(SP肂uPU؀u W8PwU؋E܀xu P0t' ut ut@pDi(+EX=,}3ۃ]E؃$5؃ ,$5@]EX e_^[ÐUSV ]3 pu PBE =uE t @ sXu P t@hDa=uB t6 sXu P t@&DD=Xu tD@e^[ÃPh3䐐USVW u6 vCt>Ft4C f ]Eww35.ؿ# SVPWV{u S~u VE wy$~D_@X|DM@FuD;@4tD)@"D@}D@e_^[ÃPh53㐐{iWUS]SƒuK=t(CuKuRQPhlUCt PaUC;tCe[à hPڐUSV=jjd'U LK4t4t44tP4tl4Y^~ LBc~ǀ H  @DP HLHP PTHP XHe^[à h0aUSVW E0S]Eww<$$ fD$l$E\$,$t$u SWtE{u S V@e_^[ÃshqsWh|륐USVW, ]3sEC3t P VEԃ P!SE@E܃\~u VExu P{tu WFhW袽S u]Eț<$$ fD$l$\$,$D$~+MH#E܉EEExu P){tP W菾]Eț<$$ fD$l$\$,$D$E؃u W}|]+]E؋+H#3ۃ=tuSuhȘQ ]MԍDUEDPWfMԋED~u VJǍe_^[ÐUSVW, ]3E PܿẼ sEЃ P輿~EԋÈ8]؛tK MӋMt8;uFB t>;t;t@8u]؛+E@EE]؛Exu P|EЀxu Pg E$u覹؋Eԍe_^[ÐUSVW<]]̋uEЋM MԋU U؉M܃ POEE܋M̀9,hMQ5+Eԃ3PEPEP %tM܈EC@E{{%uE%E@E܃ WO3+EăhMQ5E+E@PEPEP EE E@EAjMQ5+E3PEPEP  *tE VEȋv P7]EM<$$ fD$l$\$,$\$ShpIQ)O3+؉]ăhEP5]+]CSEPEP uXNEEMȀyu# Q!EElt htLuE@EWߋEċ3+EȃhMQ5E+E@PEPEPw 3wi$cEssEi{lt uEYdEOd{lEtAE@lEdEHM@%fEuhT?Eą V؋vhEP52+MH#+U+UBREPEP Eă?uh0uYMSlE PLEă uLEhEP5Eċ+MH#M+ȋEDE+EPEPEPuLLE܉E܃uh0PLcC Sf]ED@uEE܍HM@ S.]EM܋U <$$ fD$l$\$,$D$PRQ"L S- PuuK\duQ S起]EM܋U <$$ fD$l$\$,$D$PRQKfu/ S_]EE܋M$QPuKsux S{E PJ+EȉEH#E+ȉMȃjEP5M+MAQEPEP* M-QuuJUu, S誶]EM܋U <$$ fD$l$\$,$D$PRQJ{u S uIE܉E܋߀; ulIt VTvuMԋEE؋U E+u]e_^[à hzEeuht_Duh4GQuh.MPh nZndnnUSV𡼦@E PGEtaEp PS諶VMPQEPt={u SFMH@e^[à h덃uhh뮐USVW𡼦@E PGEux PSWMPQEP{u SFt? PtvP$SjWuwHSGC t#ihjWuNHį ud uBFDe_^[à hL}uhe? SPhF뜃 h4느USVW, }7Sl]؛{u Su W]Лt/ wsS,]Л{u S*؁3uEE]؛4uEm]؛w5uEM]؛`6u$ED@bE}]؛47uEED@KEPE}؃$EEMm]؛WuE]؛YEr{EPE$nE]ED@uNE]Eț<$$ fD$l$\$,$D$PE$]؛>E$E$E]Ețh0$^]؛ E$S3؋Íe_^[à hܖ hĖVh뤐US]KPEU$]EtM]E ]E蛍e[ÐUSVW E0S|]E v=GtU=ItNd E$W؃uEE$S؀{u. S uEE$S«؋Ǎe_^[ÐUSVW, ]s3؋} 8;uCFȃt`uAuhVgf VQ]Eț $S? VzPS訬' VbPS萬V[ K~ Vi SЭ]؛ V]Л$Er-EPE$A]ED@tCE$E$B]Ețh0$#]؛E]Eț<$$ fD$l$\$,$D$PE$]؛ED@EPE}؃$ AEMm]؛AED@ttE}]؛"EM]؛Em]؛ EE]؛~u V E$S ؋Íe_^[à hdL h|wWhD뒐 USVW ]3sVSޭv'?E s?MDP>t_vW?sEP?{u S>؉{C~u VÍe_^[Ãsvh뉐US]t" Px u CEe[CEe[e[ÐUSV ]s 蒝<u: 3H tuxu P<t@H sUH uHu PxCEe^[e^[ÐUSVW| }7E Pw 賜EGtC}Ot}PYE- PE P覫 EE wlE P蝡=tE@uSPVh̕m<MAA j2MAu} E-8 SU<P}PCM E t t uF t t tEF t t tuuhpEPY<WuEpjjjWEP4 2 W2<]EEpj$WEP Ä6F-E;]t ttF;]t tuuhpEP;WuEpjjjWEPo 2 Wm;]EEpj$WEP; FVaY]}E@EPhpS;EEuEpjjjWSР / W:]EEpj$WS蟠 F>x}PtjSbVWw3ۅ !ELJ !3CShpEP,:(M VuEpjjjVEP 2 V9]EEpj$VEPŸ (M5(5,~t%>t VW wFE !AC]ShpEPd9EpjjjhȕEPK E !vC]ShpEP#9Vt4 V9]EEpj$VEP EpjjjVEPʞ Exu PExu PExt}OuExu PU@EX e_^[à h3EUS ]3)H t!u P[CEe[CEe[US ]3P t(Kt1u PKMe[CEe[e[ÐUS ]3qx uC s]Ht't't"ttu P{묡De[ÐUS] 3Ht;t;t6t1t,u P# sx tDe[ÐUS E0xu P]Ct Pqx uc s ]HtGtGtBt=t8u P{ s!xu P[놡De[ÐUSVW ]3E sHHM؀xu PE؋H3EEE؋@E܋0tYvu轟vscGtWt;t6t1t,u WuE؋HEE@E;|4Exu9 PO+Exu P8=D=D=DǍe_^[ÐUSVW, ]3臓sCX'$ Fu^ V舢P3tE VoPjpt P4EE]] ]Fu V]E j4EEU ]EЛ|$D$ fD$ l$ <$l$$P4B4ȸ+i+ʉME5]  h3V_P4EE ] SVҞ]؛ Wž]EЛ$E$64]u W[g Vx]EЛ$4]< VM]EЛ$3] V"]EЛ$3]EЛh$] Vٝ]EЛ$3]EЛh($] V萝]EЛEP$1O V`]EЛ$.3]EЛh,$]FtF] VOP0EE] V!PP؃ t2tYt Q2Gu0t't Qm2Guـ~u VaSVSt/PWhx蹹~u VE$Vɘ؅t [[uhƍe_^[à h̹]~u V4E$Vj묃 hL肹t S냐EPEK%USVW uFt PvP6th VWCSP0u WC~tS400S800vuExt S5/C u De_^[à SaPh۷אU3ÐUSVW u UW^Su\tu Wpƍe_^[ÃSh8iU츨P\hȯÐUSVW3ɋ} ;YEE3ۃTtPW,tVCF tPW,t=CFtPW,t$CF$tPWk,t 0C;~k P3=t/TtPW(,uF9Eti C<|lTt PW+uF9Et:=t3CF t PW+uF9Et=t C<|k PP3ۃ8t C<| h,}t||t`tAhu 8+uvhĔu +_hĔu -Hh̔u -1hȔu +h̔u i+t# u ٙk TPXƍe_^[à h辴u hД覴Wh萴3봐UP3M; tC@;J t2@;Jt!@;J$t0@<|$*k Tk Tk T k TÐUSVW E0读S踘P3EFtzPs)ug@ F|t=t 66*E 64,E}t~Ft P#)3F G;r{u SA؃E$Sx؋Íe_^[Ãvh腳JvhlmiUSVP3t?@ C|t=t 3C) 3D+trC t=@ uxC|t=t s ) s +t^;he^[Ãsh覲^shH莲vshvpshH^덐USVP3ۋt P(F t P(Ft P(F$t P(0;~e^[USVW,𡼦E؃ P&E܅ uv W؃>tB vǸEЃ P̕jP%PEԋEЀxu PFEԃ vEЋ5@Sub]h j5(+@MPQEPC EM܉M;(sME@EAM;(r uEM8]܍uh V5+E܃PEPSж U\trM&tMEAMoBUh V5 ,+MAQEPS脶 (M,;s0(MBAM,;rEPVME8?MEE;(,]t{to8th SJ%h MQjMDM+E܍UPRQ̵ EMMQUMAMtMUBUAMuEE;uW赏5Du WEЀxu P u6$ƍe_^[à h0tuh\MuhAdUSVW<𡼦E؃ P#E܅ uv 蟵Eԃ P褒؃>t; v{W脒jPLEu WFE v:EăSu^EE !Mǀ !E܉E uEЋ=,(M3G:>EȋEЉE8hEP5+M܃QEPEP藳 M\txU&tMEAMxAMhEP5,+UBREPEPE (M,;s3(MBAM,;rEPEPqME82;phEP5+M܃QEPEP MEC@EMM;3Eȉ]hEP5++E@PEPEPi U,(M;s!UM(BUAM;r,UЉU:hEP5+M܃QEPEP M\U&tM,(EAMAMhEP5,+UBREPEP藱 ,(M;sCӊ,(MBAM4;r!EPEP,(MU:؅;{EE;ASu[=,(M] S& hMQjMD+EPEPEP訰 EMEMAMtEMEAMuEE;uu蓊EM̉ !EԀxu PrEĀxu P]CE[ uÍe_^[à hȓ4uh$uhhuh<M)USVWU ] 3~\t&tAD~A<F\t&u\A~%~&tFA~ \A&~ ;_^[US؃ S*Íe[ÐUSVWEE؋M M܉Ep؅E؈E@t%EE5_,5.t_EEEE؋E؋Uu؍}+;M|'jWjdQEPV M؅SUuetEt.t +t-uEt؋E؋Uu SUEPuM؋EM;t P%E0AE E@P؋M؋Uto}؍u+;E|#jVjdPEPW% M؅tUu_uE؋M؋Uu S UaE؋ME܋M 3ۋÍe_^[ÃQhXUQh|ޥUkUS=u 5|GU = = h|h/؅  _  H~ $! t  ]X/K(D tt6 tu Ph|h{؅ Ge[k=t j(zPh|T( =t j[yPh| [ =t j{yPh|{ Hy hd=t j)_yPh|)j Hy hl计=t j]yPh|V] Hy htc=t j;xPh|; h|PtB 5)=t h\PxPh|\[ h謠=t j;xPh|T; h5(t{[tv=Ȣt 5Ww}X5<jjjh45~ H=t hKowPh|Kz 5=t h\-wPh|o\8 h8=t h\vPh|.\=t1=t hYvPh|YYH?=t h9qvPh|9|]=t.=t j%9vPh|{%DH>=t h9uPh|;9=t j/uPh| /=*t.=t j*uPh|*-l=t1=t hYEuPh|YPH?=t h9uPh|G9H<=t h9tPh|9-tx=t.=t j-tPh|-+H;=t h9CtPh|9N[H=t h[tPh|E[+tx=t.=t j+sPh|+iH:=t h9sPh|9)ZH=t hZAsPh|ZL-=>t;H=t hrPh|0H=t hrPh|VH=t hnrPh|yZ=t;H8=t h9)rPh|k94H=t hqPh|+=t;H=t hqPh|LH=t hdqPh|oH =t h )qPh|k 4=t{ ~t1=t hXpPh|&XH =t h pPh| LH=t hdpPh|oP|t.=t j|,pPh|n|7 =t hoPh|8&t.=t j&oPh|&f =t hoPh|=t j;ZoPh|;e=t h)oPh|k4=' SnPh|:= SnPh| 5 ~5]E5<j $S5u H=t hNRnPh|N` 5pK3Ge[= =t j}mPh|2}Íe[à h@=         ;U   ;                  ;_> i             ' An                            P                            KKUSVW=xu 5t xNxpB ءxp"xpjVh+ȃQhtWe  t t u)xPh蕓\Hރ$'ЉtЃs7tDЉtЃsetDЉttppp"p|Hw$'ppZxtn3ɍxlu ȃ߃wDCt8u ȃ߃wlCt lb| P tPhxP tppp\ppptp pcppRp pAp p0p pp pppءxp"p 5xxp pQpAp5<jjjP5xo H=t hOZhPh|Oe_^[à h角xPhԞ茒 hw %4%4%4%4%4%4%4%4%4%4%4%4%4%$$$$$$$$&C%C%C%C%+&M&C%C%C%o&C%C%C%C%C%C%C%&C%C%C%^&C%&C%<&C%V%USVW]KxHEEE E3<k M4u}_~w;~Ǎe_^[ÐUSj+huxk HuQ=t h=f PFfPh|A=*uQ=Ȣt hx葎= PePh|0=LuW5<jjjh\hl H=t hLePh|L=TuQ=Ȣu h`ۍ=X P8ePh|z3=& PePh|H(=ȢtH uld|6H=t h!dPh|!5<jjjhXuk H=t hJQdPh|JP5<jjjhXu1k H=t hMcPh|AMe[ÐUÐUSVW=pu 5lp2pEXءpM/pujVh+ȃQhlWy  tVb+^ )%k()*+i/123YF_, !"%hF*mIKMNLQ5V:6g`DFUVWmcd|}~23E %()*+/12389@ABCFFGMNQVV]`ikmpqrstuwxy{ ,-/5679;MUVWXYZ^_`deiklm   $ <>A,-./01234S6789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-./012346789;<=KLM UVWXYZ^_`abdeiklm,-/1679;KLM UVWXYZ^_`de iklm,-/1679;,-/KLM5679;UVWXYZ^_`deMiklmUVWXYZ^_` de iklm"#%&'()*+,-/679;MUVWXYZ\^_` de iklm"#%&'()*+,-/679;MUVWXYZ\^_` de iklm"#%&'()*+,-/679;MUVWXYZ\^_` de iklm"#%&'()*+,-/679;MUVWXYZ\^_` de iklm"#%&'()*+,-/679;MUVWXYZ\^_`deiklm "#%&'()*+,-/679; MUVWXYZ\^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679;MUVWXYZ^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\]^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"#%&'()*+,-/679;MUVWXYZ\^_`de iklm"%&'()*+,-/679;MUVWXYZ ^_`deiklm%&'()*+,-/679;MUVWXYZ ^_`deiklm%&'()*+,-/679; MUVWXYZ"#_`de+,-i/klm679;M UVWXYZ\]^_`de"#iklm+,-/679; MUVWXYZ\"^_`de+,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de+,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de,-i/klm679;D MUVWXYZ^_`de,-i/klm679; MUVWXYZ^_`de+,-i/klm679; MUVWXYZ_`de,-i/klm679;MUVWXYZ^_`deiklm<J=E]><<<LM<&<34Di< <<8?@j|4<R%iA <<<<<<d1BE2%C&l<<A<<F<<<G{|<<#<=PU <'<<<<<<<<<<&<!e<<@<B<<}~<<<"T058<:O<C<%<()*D+S/\ka<b<<<<;<<<<fHIKNkznWX<<Y<z<KLj<V%z  zzzzzzzzzzzzzzzzzzz <>zzzIKzz,-.*5zzzzzzzzzzz**5123O5P Q MNQRSTUVW`XYZO[\ Q ]^ !"#$%RSTUVWXYZO[\ Q ]^ !"#$%RSTUVWXYZO[\ Q ]^ !"#$%RSTUVWXYZO[\ Q ]^ !"#$%RSTUVWXYZO[\ Q ]^ !"#$%RSTUVWXYZO[\  Q ]^ !"#$%RSTUVWXYZO[\ Q G]^ !"#$%RSTUVWXYZO[\ Q c]^ !"#$%RSTUVWXYZO[\ Q ]^ !"#$%RSTUVWXYZO[\ ]^ !"#$%TO[\  ! " #$%T[\ !"#$% !9l"#$%mnopqrstuvw !9l:;#$%mnopqrstuvw !9l:H#$%mnopqrstuvw !9l:J#$%mnopqrstuvw !9l:#$%mnopqrstuvw !:#$%9lmnopqrstuv w !:#$%  !"#$%  !"#$%  !"#$%$  !"#$%$  !"#$%$  !"#$% !9l"#$%mnopqrstuvw !9l:#$%mnopqrstuvw  !9l:#$%mnopqrstuvw !9l:7#$%mnopqrstuvw !9l:9#$%mnopqrstuvw !9l:Z#$%mnopqrstuvw !9l:[#$%mnopqrstuvw !9l^:#$%mnopqrstuvw !9l:g#$%mnopqrstuvw !9l:#$%mnopqrstuvw !9l:#$%mnpqrstuv9l !m:#$%pqrstuv9 !:#$%9no !:#$%9F !no:#$%9n !:#$%  !:#$%  !"#$%9 !"#$%  !:#$%9  !"#$%  !"#$%9 !"#$%$  !:#$%9 !"#$%9 !:#$% !:#$%ng R^ "%j )l,\iqyllEl,^l ,,5@Y l   lA  <<<,l o ,%v         lllll  7 7 =l B >QlK K 8 S{ddddddd  l<::<<<l l l 7 b7 7 7 7  r lll, 7 7 l P $ 1l 37 7 , ^   E xy_`mh_?ab'(6)c6d+,7efg-./0hXY!`$-#M^NZ[_k VWpujS~"L/lnoityz| wQTg:;}(&.KGF@ABCDEH?>^<)* OPams {q \x9%JI0b+^^ v]U65743Rdef1=ch'^82,r   oppqqrrssttuuwvxvyvzz{||}}~~g fd e]\   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[^_`abchijklmnAF;Oduplicate argument %syou can't define function %s more than once%s is an array, not a functionparser stack overflowsyntax errorindex() doesn't permit regular expressionsnextfile is illegal inside a functionnext is illegal inside a functioncontinue illegal outside of loopsbreak illegal outside of loopsillegal statementprint > is unsafeprint >> is unsafeprint | is unsafecmd | getline is unsafebailing outb.cout of space in cgotocgoto overflowout of space in cgoto()c == HAT || c < NCHARSnonterminated character class %.20snonterminated character class %.20s...out of space for reg expr %.10s...out of space in reg expr %.10s..xdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumillegal primary in regular expression %s at %ssyntax error in regular expression %s at %sreparse <%s> out of state spaceout of space in pmatch*q < NCHARS*p < NCHARScan't happen: unknown type %d in firstout of space in first()can't happen: unknown type %d in cfollout of space building follow setout of space in cfoll()regular expression too big: %.30s...cclenter: in = |%s|, out = |%s| out of space for character class [%.10s...] 3out of space for character class [%.10s...] 2out of space for character class [%.10s...] 1can't happen: unknown type %d in freetrcan't happen: unknown type %d in penterout of space in makeinitout of space in makedfaout of space for faout of space initializing makedfaawk %s program = |%s| can't open file %sr-errorflag=%d argc=%d, argv[0]=%s no program givenunknown option %s ignoredobsolete option %s ignoredfield separator FS is empty too many -f optionsno program filename-safe--Usage: %s [-f programfile | 'program'] [-Ffieldsep] [-v var=value] [files] Cversion 20050424defining func %s (%d args) `%s' is both function name and argument name`%s' is an array name and a function namelimited to %d pat,pat statements%s is a function, not an arrayout of space in nodeallocNOTCATVARMODADDSUBFORARGBORANDCCLALLDOTGETLINEREGEXPRPREDECRPREINCRSPRINTFLSUBSTRMATCHOPPASTAT2PROGRAMtoken %dLASTTOKENINDIRECTDECRINCRPOWERUMINUSWHILERETURNSPLITSUBSTRSTRINGNUMBERCALLVARNFIVARPOSTDECRPOSTINCRCONDEXPRINTESTELSEPRINTFPRINTPOWEQMODEQDIVEQMULTEQSUBEQADDEQASGNOPASSIGNDIVIDEMULTMINUSNEXTFILENEXTMATCHFCNINDEXIFGSUBFUNCEXITDODELETECONTINUECLOSEBREAKBLTININNELTLEGTGEEQAPPENDPLUSQUESTSTARORCHARNCCLFINALNOTMATCHMATCHARRAYNLXENDXBEGINPASTATFIRSTTOKENFNRORSOFSENVIRONRLENGTHCONVFMTnewline in string %.20s...out of space in qstring(%s)out of space in tostring on %sgetsval %p: %s = "%s (%p)", t=%o %.30ggetfval %p: %s = %g, t=%o read value ofsetsval %p: %s = "%s (%p) ", t=%o r,f=%d,%d setting field %d to %s (%p) starting setsval %p: %s = "%s", t=%o, r,f=%d,%d funny variable %p: n=%s s="%s" f=%g t=%ocan't %s %s; it's a function.can't %s %s; it's an array name.setfval %p: %s = %g, t=%o setting field %d to %g assign tosetsymtab set %p: n=%s s="%s" f=%g t=%o out of space for symbol table at %s(null)setsymtab found %p: n=%s s="%s" f=%g t=%o can't happen: inconsistent element count freeing %sout of space in makesymtab%dARGVARGCSYMTABRSTARTSUBSEPNRNFFILENAME%.6gOFMT RS FS$zero&null0 %d extra %c's source file %s in function %srefldbld: i=%d %s result out of range%s argument out of domain <<< >>> context is source line number %d, file %s- input record number %d extra %c %d missing %c's missing %c floating point exception %d at source line %d%s: %srecbld = |%s| in recbld inputFS=%s, fldtab[0]=%p built giant record `%.30s...'recbld 3recbld 2created $0 `%.30s...' too longrecbld 1no match %s match %s (%d chars) into refldbld, rec = <%s>, pat = <%s> out of space for fields in refldbld %dout of space creating %d fieldstrying to access out of range field %dfield %d (%s): |%s| record `%.30s...' has too many fields; can't happenout of space for fields in fldbld %dcommand line set %s to |%s| getargv(%d) returns |%s| readrec saw <%s>, returns %d readrec 3readrec 2input record `%.30s...' too longreadrec 1field separator %.10s... is too longcan't open file %sropening file %s argno=%d, file=|%s| RS=<%s>, FS=<%s>, ARGC=%g, FILENAME=%s FILENAME%dout of space in makefields %d0out of space for $0 and fieldssub???explogpow(array)gsub result2 %.30s too big; can't happengsub result1 %.30s too big; can't happengsub result0 %.30s too big; can't happengsubout of memory in gsubsub result2 %.30s too big; can't happensub result1 %.30s too big; can't happenout of memory in subi/o error occurred while closing %si/o error occurred closing %si/o error occurred on %sillegal redirection %d-raw%s makes too many open filesnull file name in print or getline/dev/stderr/dev/stdout/dev/stdincan't open file %swarning: function has too many argumentsillegal function type %datan2 requires two arguments; returning 1.0sqrtsplit: s=|%s|, a=%s, sep=|%s| illegal type of split(regexpr)out of space concatenating %.15s... and %.15s...illegal assignment operator %ddivision by zero in %%=division by zero in /=read value ofillegal arithmetic operator %ddivision by zero in moddivision by zerowrite error on %swrite error on stdoutprintf string %.30s... too long. can't happen.out of memory in awkprintfsprintf string %.30s... too long. can't happen.out of memory in awksprintfcan't happen: bad conversion %c in format()huge string/format (%d chars) in printf %.30s... ran format() out of memory%snot enough args in printf(%s)weird printf conversion %s%dformat item %.30s... ran format() out of memoryformatout of memory in format()substr: m=%d, n=%d, s=%s illegal field $(%s), name "%s"trying to access out of range field %sout of space for temporariestempcell list is curdledfreeing %s %s %o unknown relational operator %dunknown boolean operator %dout of memory in intestout of memory deleting %s[%s...]out of memory in adeletemaking %s into an array out of memory for %s[%s...]out of memory in arrayout of memory in getlineillegal jump type %dbad type variable %dargument #%d of function %s was not suppliedarg(%d), fp->nargs=%d %s returns %g |%s| %o finished exec of %s, fp=%d start exec of %s, fp=%d out of space for stack frames in %scan't use function %s as argument in %s(null)args[%d]: %s %f <%s>, t=%o evaluate args[%d], fp=%d: function %s has %d arguments, limit %dfunction %s called with %d args, uses only %dcalling %s, %d args (%d in defn), fp=%d out of space for stack frames calling %scalling undefined function %sillegal break, continue, next or nextfile from ENDillegal break, continue, next or nextfile from BEGINillegal statementout of memory in %ssubsinlogintforexpcosENDextra )extra ]extra }lex %s touppertolowersprintfgetlinepushed back too much: %.20s...non-terminated regular expression %.10s...newline in regular expression %.10s...out of space for reg expr %.10s...out of space for rex exprreturn not in functionillegal nested functionsystem is unsafe%xgiving upnon-terminated string %.10s...out of space for string %.10s...out of space for stringsunexpected end of input after $(NF)out of space in yylexout of space for number %.10s...out of space for name %.10s...whilesystemsubstrsrandsqrtsplitreturnrandprintfprintnextfilenextmatchlengthindexinifgsubfunctionfuncfflushexitelsedodeletecontinueclosebreakatan2NFBEGINj/z///////// 00*0:0J0Z0j0z000000000 11*1:1J1Z1j1z111111111 22*2:2J2Z2j2z222222222 33*3:3J3Z3j3z3  . ." \  oo,oD-$-0o`o2dd22u23܂3Ԃ$3̂43ĂD3T3d3t3P88880,,888888888888L8 8,8H8l88(888$888܊Ԋ̊Ȋlhdx`\plhd`\XTXLD<0($TP L؉ЉȉHxph\PDD<4,$xp @<܈ЈĈȦ  F` @, @  ?Lp`LL| "t##l$$`%%\ "X&&T''LCCD((X"<"T))4**(**QQ ,,--  ..P""L"001122@@ܟAAԟ"̟TTH "ğSSBB""D++RR" " "UUanotate anotate0 ,(33.)4anotate4$H4 4WT8XXXXS 44#ThXhX,XX :T;;;;;;;;;;;;od&;;;;;;;i0 Y+ ;;I ;;d,d@#c ;;;t;`;;;;;;;;( ;; 6 \ >  ;; g C & ; [ 7  ; ; ;; g A  sGq9P|h.O<p;;g9uI&X$T Yanotate0 ,(:TTHRUHRURUQ UHRUHRUHRUHRUHR UHR$UHR(UHR,UHR0UHR4UQ8UQW>W\>W >W=W=W=WI=W<W}<W;W;W;WHRWHRWt;WF;W#;W;W:W:W:WV:W3:W:XXXXXXXXXXXXXXXXXXXXanotate $Y"+$Y<[o\`|$aa dixj)jdk nplq"qist\tu{K\P4___~`eg hiulyluy0ghioooooo??T09eg""""""0``HHHHHH---0X__DDDDDD...<ydi(g(`(_( wwBx /[8`S```g9anotate@ <8[_______________________```X``X``X``X``X``X````=``=``=`p"t" x"i|"""" "" "" " " " " " " " " " " "' ""A"n" " " " " " " " " " " # # #  # # # # #  # $# (# ,# 0# 4# 8# <# @# D#H#L#PP#T# X# \# `# d# h# l# p# t# x# |# # # # # # # # # # # # # # # # # # ##K##K$'?%'' %'4%'4%'4%'4%'4%'4%'4%'4%'4%'4%'4%'4%'4%'$'$'$'$'$'$'$'$'&'C%(C%(C%(C% (+&(M&(C%(C%(C% (o&$(C%((C%,(C%0(C%4(C%8(C%<(C%@(&D(C%H(C%L(C%P(^&T(C%X(&\(C%`(<&d(C%h(V%@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)stdio.h 1.84 04/09/28 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)locale.h 1.20 03/12/04 SMI@(#)locale_iso.h 1.3 03/12/04 SMI@(#)libintl.h 1.16 04/09/28 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)signal.h 1.43 04/09/28 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.6 03/05/02 SMI@(#)unistd.h 1.43 06/03/10 SMI@(#)signal.h 1.66 04/09/28 SMI@(#)siginfo.h 1.59 04/07/15 SMI@(#)machsig.h 1.11 03/09/26 SMI@(#)faultcode.h 1.15 92/07/14 SMI@(#)procset.h 1.25 04/07/16 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)errno.h 1.17 03/01/03 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)stdarg.h 1.47 04/09/28 SMI@(#)stdarg_iso.h 1.4 04/11/19 SMI@(#)va_impl.h 1.1 04/11/19 SMI@(#)stdarg_c99.h 1.2 04/09/28 SMI@(#)assert.h 1.10 04/05/18 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)setjmp.h 1.38 04/09/28 SMI@(#)setjmp_iso.h 1.2 04/09/28 SMI@(#)limits.h 1.59 04/08/24 SMI@(#)limits_iso.h 1.2 03/12/04 SMI@(#)int_limits.h 1.9 04/09/28 SMI@(#)math.h 2.24 04/10/23 SMI@(#)math_iso.h 1.9 04/10/23 SMI@(#)math_c99.h 1.9 04/11/01 SMI@(#)floatingpoint.h 2.9 04/10/23 SMI@(#)ieeefp.h 2.12 04/10/23 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)time.h 1.45 08/01/09 SMI@(#)time_iso.h 1.4 04/09/07 SMI@(#)types.h 1.86 07/09/20 SMI@(#)machtypes.h 1.11 04/09/28 SMI@(#)machtypes.h 1.2 04/09/28 SMI@(#)int_types.h 1.10 04/09/28 SMI@(#)select.h 1.19 04/01/28 SMI@(#)time_impl.h 1.11 05/05/19 SMI@(#)time.h 2.76 05/06/14 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03@(#)stdio.h 1.84 04/09/28 SMI@(#)feature_tests.h 1.25 07/02/02 SMI@(#)ccompile.h 1.2 04/11/08 SMI@(#)isa_defs.h 1.29 08/06/06 SMI@(#)stdio_iso.h 1.8 05/08/16 SMI@(#)va_list.h 1.15 04/11/19 SMI@(#)stdio_tag.h 1.4 04/09/28 SMI@(#)stdio_impl.h 1.15 07/03/05 SMI@(#)stdio_c99.h 1.2 04/03/29 SMI@(#)stdlib.h 1.51 04/06/30 SMI@(#)stdlib_iso.h 1.9 04/09/28 SMI@(#)stdlib_c99.h 1.2 04/03/29 SMI@(#)string.h 1.27 07/01/14 SMI@(#)string_iso.h 1.5 04/06/18 SMI@(#)ctype.h 1.35 04/09/28 SMI@(#)ctype_iso.h 1.3 04/09/28 SMI@(#)ctype_c99.h 1.2 04/09/28 SMI@(#)assert.h 1.10 04/05/18 SMIacomp: Sun C 5.10 SunOS_i386 2009/06/03iropt: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ir2hf: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ube: Sun Compiler Common 12.1 SunOS_i386 2009/06/03as: Sun Compiler Common 12.1 SunOS_i386 2009/06/03ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.493.interp.SUNW_cap.hash.dynsym.dynstr.SUNW_version.rel.data.rel.bss.rel.plt.text.init.fini.rodata.rodata1.got.dynamic.bssf.symtab.strtab.annotate.comment.debug_loc.debug_info.debug_line.debug_abbrev.shstrtab oD  \ \ !""" )o,,P7 B$-$-A B,-,-J BD-D- NT/T/0S33PY.._..e//Pm v{;pp4 E$ o/# 07070161cd9ac5000081ed0000000000000000000000014ad9c49c0000a090000001220000021fffffffffffffffff0000001700000000root/opt/pkg/bin/nbsedELF@4М4 (44oWWWWPxXxX/usr/lib/ld.so.1a^  !"#$%(*,./23469:;=>?BCDGJKLMOPQRTUVWXYZ &')+-01578<@AEFHINS[\]O/ 1I . &-Lq 5N <HYEqK ipqw| )p pY[xX(P `Mt xqWs$,l @@q !q  pd2]  % P +4m8q>qFLYUdY]`esl0sz0"W@ qH3   qDPP   ss$ ,2{ 8BmGP`Us^mdjq|q=HY!w#2c ~P02 vspP M _m!setprognamecfclosexmallocmf_fgetsatexitcompilefgetln_environmatch__1cG__CrunMdo_exit_code6F_v_getenvfname_exitstrrchr__filbufmainvfprintfstrerror__longdouble_used_edata_DYNAMICfgetc_finicspaceaflag_etext_endcu_fgetsstrdupfwrite__ctypestrcmpstrregerrorregcomp_initsnprintferenflagmaxnsub__environ_lock___Argvregexecoptargstrtolungetc_get_exit_frame_monitor_GLOBAL_OFFSET_TABLE__startlinenumprocess_PROCEDURE_LINKAGE_TABLE_strchrerrnoatoi_lib_versiongetprognamefopenappendnumappendsmemchrxreallocfread__fsr__fpstartprog__flsbuffreelastline__iobioctlstrleneflaggetoptmemmovesederr__fsr_init_valueoptindstrcpymemcpylibc.so.1SUNW_1.1SUNWprivate_1.1/opt/pkg/lib'= qN lY q!q8s.mKsWWDW WWUW7WMW<WW$W/WWRXGX"XP XXXIX&X' XX$X(X0,XB0X@4XS8XPjURQt`|$уtY D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]U mP]3ɉj5ms~ k Ps qkPqÐUSVWEEhh[@Et?t8u.qt Ftuqut#;uF띃 jO؋EcP]h,VVu3CCE9 jCPV.t@t<u1qt"Ftuqu<,tCEGt@Ft8u.qt Gtuqu j=CPWiEtGtCu8qt)FEtuquׄuhVjCYYtY;t uuPhVjGM;~ QPPhUje G $Ft?t8u.qt FtuquK# ȉKSFV1 t^t>€uAqt2@t€uqu;9;0;"hPTjQFt\uhTj- j CPVEuhTjsNVsP t@t<€u1qt"@t€uquހ;3Gt@Ft8u.qt GtuquhTWbC WKuhTj  SYBFt@t<u1qt"Btuquބu C &hTRC BFt@t<u1qt"Btuquބuh Uj'hTREC GFt@t<u1qt"Gtuquބuh UjhUW C =xqu'hh WCKCGFt@t<u1qt"Gtuqu<\tCPhhUjAtBGtWu6qt(At7uqutCPh4Ujr C K}܅uhUjeE܉At]Ft>€u@qt1At€uqu <;<;F;trCPhUjYFt?t8u.qt FtuquE܉CE]܀>hh[tqpzpr}th;t.nt\t:u9wE@EF( FEEIME@ E@EFEF(VEPGuhSjE` E@33u e_^[ÐUSVEu YF^u VCFQ]uC@3ʋր]tv[t\uQK{nuH AS.t :t=u.P ]u;t3t'C@ ]u;uC@ хt]u3]t3CM@^[ÐUSVPu؅tV Pu E b jdu 5mQPȋt6 j/M 5q+J#+5qÍe^[ÃPQ PhSj뻐USVW,ExEM MAqA hE3EE3]]Љ]<\t-t3-;M< hxSjWzuGu Ok3QhSJt>\CHЉMŰRt; vPhSjE̋M9H}H&t\u\CCGA+]]ԉ]ԋM؋+=}ɉM؃QuEЃhhc c'+]܋EԍDPuM̉AGhHSj?33e_^[ÐUSV3ɸ] KKC 3MtLtH€u=qt.MEHM@tuquȄ< Qσ w=$"thSjxj EPuMK$~ uFp hQj?  Vu΃E@E~e_^[USVW ] 3& h\VS}3Wu /wd$d+m~qr5sjX|q5sj9xq-%E%PuhVhmj*h\VVWLsU 4 |q utPjyvt Pu jCj5m"hm~u j}3e_^[à 5q PhVjfƐ\*\*\*\*\*\*)\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*\*P*\*\*\*1**\*\*\*\*\*\*\* *USVW ] 5Z mug$m3ɉ qP;uDhVpA(m m$m@qZ뜃t\ 5(mSu$m$m 5(m m3Z;$mphtVj4mVrhlVhLm5q$mH mZ=qu9#uynu qUC؋t$ tnA mBFC؃3Z$m3;HuV$mX3k qA quYM9#uQynuKq? BA mqE%$mqEqE3] e_^[à 5q $mPqh|Vj<US=,m0mmt'qhVPЉ,mu,mqdVӋ I y: R,mu/ R0m@0m뀋BHJRP=stE@3kEP5,m6ء,m@ t0qu PfP5qh|Vju uSu,mq I  R,mm R0m@0mtqt'qhVPnЉ,mu,mqdVӋHxBHJ Rj,mts,BHJRP? s3e[à 5q%P5qh|Vj,m 5qP5qh|Vj,m'U j ]MHM H ZZÐU j%P@ ZMZUS uG؅tÍe[à 5q( PhWjՐUSEtu P؅tE Ee[|Íe[à 5q PhWjfՐUSVTmt Pjh Wu ]SVTmVPu S~Tme^[ÐUShWmSEtu5q5qhVSEPu S%hVSg}ue[à jnUSVW<qjhhm# 3pmm;M 5q3XmKS;u5AC*A hmMċ5lmt\m39\muh,WjvFMĀ< u FPujjVuW 7 j5qjW5\mWu  3u5q5qt =su;qt3-C8u;psK5q XmB hmMċ5lmt\m39\muh,WjvFMĀ< u FPujjeVuW7 j5qjW5\mWu 3u5q,t =su;ruc5qXmtt s;qA hmMċ5lmt\m39\muh,WjuvFMĀ< u FPujj?VuW7 j5qjW5\mWu 3ɋ5qCtȅ%CƃC$?VhWN5q=pmhmlmI3+@u3rAsBsBBsBBsBwÅtsBIu5qY=mujjhWhm5qhm lmEȉM̡pm tmEЉMԋxmUءm mhm lmm mpm tmmxmEȋṂm mEЋMԣm mm=pms{u#hh s ]5lm5hm6;lm5q==`mM+ S$5q `m`m q pmuhm5lmj5hmV* jds9dm|*k P5s ssɉ sdmk sdmK k sH s 6 dmk  sAdm5q@dm9=pm,lmHPj 5hm=lm hmt*+@lmhmPjQ^5q=lmhmWjQ<5q=pmhm5lmj5hm 5q jhhmt 5qcq pmuhm5lmj5hm j5q#q pmuhm5lmj5hmpD jhhmY5qpm 5hm35qs hW5qj5lm5hmhm5qgj5lm5hmhm5qA=mujjhWhmgj5m5mhhmL5qj5m5mhhm&5qpmlm39Ct =Xms hW5qs9dm|*k P5sQ ssɉ sdmk sdmK k sH s  dmk  sAdm5q@dmg[[ `m[Clmtf=pmusHPj 5hm't8Xhm+@ lm+ȉ lmQSRm"pmpm pmq pmuhm5lmj5hme jhhmzWe_^[Ã5\mV, PhWj|375\mV PhWjS385\mV PhWj*35 5q^Ps hWj 5q5Ps hWj5q" j4===7======U===;;=====:=9================<1=H<==="<;s;==W;=:=b:9O988==x8707=6===USVWLhmEEăEAEt=lmE\md\mtC9Aw=lmLAqEċ@ph|Wj2=lm=\mt=lmh,Wj v G< u GP7ujjWSVT>q@ j5qPV5\m?V4qm lmMMċI }AEH}u;H tCjQShm Eċ@pShmI qH@ ;t )E3EItjjQhm qjAQShmq q@\@)EE}E\mG|; u GPujjzWSV>q@ h5qPV5\mVu qWEH}u;H tCjQShm Eċ@pShm qH@ ;t )E3EIujAQShmK qjjQhm0 q@\@)EE}=\muh,WjVEH| u GPujj#WSV>q@ h5qPV5\mV~u qxjuShmT QUă}@ ؋M+}=\muh,WjgEv H| u GPujj0WSV>q@ h5qPV5\mVuqML@ ؋M+}E\mv G|; u GPujjWSV>q@ h5qPV5\mVuqMb3jhm+HQRhmEEpShmq@ jM+QPhmYhm lmEȉM̡pm tmEЉMԋxmUءm mhm lmm mpm tmmxmEȋṂm mEЋMԣm mmmm]Cxthm5lmj5hmCxtf=pmu]x u,hh Ep KA 5lm5hmEp \;lm 3e_^[Ã5\mW PhWjX5\mW PhWj1a5\mW PhWj 5\mW PhWj 5qPEphWj 5qPEphWj5\mW PhWj`USVW =dms33 0uhmqjqsu~hxWq؅t`Sh jP~2hmPjPSh jP΃ Ssss G;=dmEm t*qu P PhlWjC3`mdme_^[USVW}=[uZ hWt P[3EPhhTjuE [<[/\W3;[| hhW?3uNqWt?<\t;mHmx mAmhmPgCmHmxmH m\hmj\/PVtI mI mx mQm+ƊPWhm+PWPPhHW>GmHmxmH m$hmj$}mHmxmH m hmj Km t*qu PC PhlWj}e_^[ÐUSVWEEP8uFÅM M܃&tu\u,qtF}V\t&uF؋EH;r%Wp MA y9yGEPBP3kM qAtjY tb+؋MIT;r4WEp &MA y9yqE@SEPWJEPӉPFÄ]C;r"Vs C s;{e_^[ÐUSVW ]u~G;FvWv oF ~}uFSu FPEXXe_^[USV]u ;tQCsuC@ uGC@ +wuCugC{u3s;u]e^[à Pt 5qPCphWjO뀃 P}t 5qxPs hWj`USVW = [u'[ h0 [[ u ؋5[ [ [};r(VPtJ [ [5[Q[ʃ tQ W؋5[ [ [u+q 5 [q [3U u33e_^[Uj/u:t@[E[ÐU[UWVS[í[^_UWVS[Ñ[^_$NetBSD: compile.c,v 1.7 2005/11/30 21:07:14 schwarz Exp $$NetBSD: main.c,v 1.5 2004/08/21 08:39:54 jlam Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $NetBSD: misc.c,v 1.3 2004/08/21 08:39:54 jlam Exp $$NetBSD: process.c,v 1.9 2007/03/07 19:18:39 rillig Exp $unused label '%s'duplicate label '%s'undefined label '%s'whitespace after %sexpected context addressunterminated regular expressiontransform strings are not the same lengthunterminated transform target stringunterminated transform source stringtransform pattern can not be delimited by newline or backslashbad flag in substitute command: '%c'no wfile specifiedmore than one number or 'g' in substitute flagsunterminated substitute in regular expressionunescaped newline inside substitute pattern\%c not defined in the RE123456789RE error: %sunbalanced brackets ([])newline can not be used as a string delimiter\ can not be used as a string delimiterextra text at the end of a transform commandunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashempty labellabelbranchread command%s: %sw commandfilename expectedextra characters after \ at the end of %c commandcommand %c expects \ followed by textextra characters at the end of %c commandunexpected }command %c expects up to %d address(es), found %dinvalid command code %ccommand expected0123456789/\$unexpected EOF (pending }'s)ae:f:nEstdin ...""%s"%s: %srstdout: %susage: %s [-aEn] script [file ...] %s [-aEn] [-e script] ... [-f script_file] ... [file ...] %lu: %s: sed: %sCOLUMNSRE error: %sfirst RE may not be empty%03o\abfnrtv\ \ stdout: %sr\%d not defined in the RE%lu %s: %s %sxX&6FVfv&6FVfv&6 P (P   o7o oP@  o`oW0{}abcdDgGhHilnNpPqrs tw xy !:#=0m$mWanotate anotate0 ,(HxXV(PhYlYanotateLeLq$#$D&~x' ((sL)e0D  "%&` &&*8888888888>42!"=8naP o$&X",0anotate qimuBNCA{5!""9!"9!"9!"9!#9!#9!#9! #9!#9!#o!#" &&&3&&A&&A&&A&&A&&A&&A&&A&&A&&A&&A&&G&&&&&&&&&&&&&&&&&&&&&anotate0)0$,l.D17|15)pc+)d+dddddddddddddddddddddddddddddddddXddd9ddddddd d+anotate )d+d+\*h+\*l+\*p+\*t+\*x+\*|+)+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+\*+P*+\*+\*+\*+1*,*,\*,\* ,\*,\*,\*,\*,\* , *anotateH101I2cd2]2 32anotate anotateH3kH @LlH,ISKs`MtMH3 ? 7?H$;fJUBk#) ?anotate0 ,(7??=?=?=?7 ?=$?=(?=,?=0?=4?=8?U=Y P P_(P(PeDPDPFmQQ5vWW{xXxX;HYHY[[E[[o[| fU5 070701f34984c5000081ed0000000000000000000000014ad9c4320004458c000001220000021fffffffffffffffff0000001700000000root/opt/pkg/bin/pdkshELFD4A4 (44o $/usr/lib/ld.so.1  !$',-./026:;<=@ABDEHKLNOPSUWZ[^_`dfghjlmprtwxy{}~    "$%&)*+-./1234689:;=?ACDFGJMOQSTVWYZ[\]^_`bdeghijklmnqrstuvz|~ "#%&()*+1345789>?CFGIJMQRTVXY\]abceiknoqsuvz|  !#'(,057<>@BEHIKLNPRUXacfopwxy{}m   !lAc W  *j1 =C{ "k H\^ QD4 ZxCa id@g ql?; B(?d> T= Ae  (# } % c \+s PH ]  q .p\, 80U ?W I5 QLu Y(DcPdG lh$ vP:  d Բ[ @% H  > 9v F>  >.X x  Cp& , 6gp = 6 I Pp| U Z  bhL  t@zD  I B`@ ~ A,F {~ >4  ȩC C    d ) 7GhAO@XHD]$M  eԺ kCrZ {X?B@     g< ?>؁ 4 T  (  81  L /     *_ 2hV ;(BCH_ K@TF Y b i(Cp4^f x  C|j; A8@_b 8< j ?7& 0o AS _` |B& DB6 A'B/ 5  EqJ S@ fCm  s>}h @  |  TO    F v< ,c E{ hBx? k p (@O 0S $Xed 4\B ;f Bt2 S ZH c? kp? |tO `n B( Z HA4| U$ X>E7  L Z d ^E  xBh!m% D $ X  +$ 9(A `u aZ *8A6 A< H@PX \o cg z\_ ?b kXApK y { P r |  ~ h 8Dq3 ?Pp ^ \!  ?5 d|  @    ` ' k 3 B: 8BB D N CU  \ 9 i k r ?{  t>$   ;q j%   p~ Ph  $  {@ 8 HB i 2*  XB @gK s  ? k " D * D6 h>Zć. = hCE  P g. W @` }  g  { 4/ p $ 0S 8Cо @    4 A% Xp d  , %l8 KS T .  h CAo  a.  ? /    ,:$ ( , . j1 5 ; h* E \-3 M  Z 6 d T{ j f: q  }  f< C  xAWXD C `2,   q d] X @  wO A$ t{9  K 8h]    x@&  3 H@;  F @N x T ,Y Z C6A` 8jA r @| @  F 0 A B   X] B> l #  pin    Z P`@     `  ^   >  & h@x> EW A. >5 ؐ~ ) H?? ( G XC N { _ H>i c u y4 | 5   x! X@ B 4 <d ?  55 h?   l E t ( Bl i Ш lG L )0\ 98?@8> Zbht > i rT@ y> ( C H8k Pq. q o i 7   t4  x.  (0 shf_getchar__ctypeblock_pipec_typesetcoproc_write_closesetexecsigfindhistflushcomsetgidprocpidpr_list__environ_lock_lxstatruntrapsgeteuidshf_writeintvalruntrapmemseterror_prefixevalonestrksh_getopt_resetc_timessimplify_pathshf_finishinitkeywordsbi_getnhistposblocking_readtty_closewdscanc_commandtdeletec_labeltcgetattrwarningfshf_sopenfatal_trap_checkc_exitreturnbi_errorfset_promptshf_reopenshf_iobset_current_wdc_brkconttrapsigafreekshbuiltinsxstrcmpshcomexecwaitlast_edatasiglongjmpclassifyj_initsetctypessavefdtsortsubst_exstatx_vi_endkshnameslashshf_fprintfioctl_startXcheck_grow_getuidc_aliasj_stopped_runningfclosearesizeset_arraychdirshf_flush__1cG__CrunMdo_exit_code6F_v_x_do_commentreadlinksetstr_GLOBAL_OFFSET_TABLE_shl_stdout_okksh_tmout_state_fxstattouppersrandc_printmpsetmemchrtty_initkillpgtcsetpgrpreaddirtaliasesshf_vfprintfc_trapksh_dup2getegidreallocj_notifyprint_columnsglob_strmainshf_getsefindcomksh_getoptx_print_expansionssm_defaultyyerroropenpipesetpgidquitenvsigtrapsc_cdgoptionsc_testunlinkinitvarx_colsksheuiddbtest_tokenstmpdirstrcasecmp___Argvcoproc_readw_closefreadstrrchrsethistfileshf_putcharc_fgbg_xstatalarm_initc_builtinglobalv_evaluatesigaddsetwaitpidshellcurrent_wd_sizegetopts_resetprint_value_quotedgetgidpushsstrstrsethistsizesetrlimitx_cf_globx_basenametty_devttyc_fcget_phys_pathgmatchj_asyncc_umaskstr_val__fsrgetpidisattycoproc_cleanupx_initmemcmpfptreefc_whenceinternal_errorfx_putcsetintcleanup_proc_envkshpidstr_zcpypr_menuifs0restoresigsx_emacs_DYNAMICshf_scloseconfstruser_optx_putsfopentsearchwdstripj_exitafreeallsafe_promptsubstituteget_ttyksh_tmouthistnumspacenice_environc_ulimityylvalbuiltin_argv0snptreefsigactionhistappendtest_parsesigemptysetppromptstrip_nulscan_seekshf_openc_unaliastimex_hookultonshf_closedef_pathinitctypessettrapnullidentseteuid_get_exit_frame_monitormemcpysigsetjmpincludec_shifthist_initsigprocmaskparse_argsmchecktolowertest_evalc_unsetshf_seekatoistr_savej_resumeqsortpdb_closeexchildexecuteevalstrhistptrtcsetattris_wdvarassigngetrlimitskip_varnamearray_index_calcmake_pathsearch_accessc_waitfcntlinfofd_clexecc_killj_systimetcgetpgrpksh_versiongetcwdx_modeshf_smprintfmaketemp_sysconf_finicleartrapsdebunk__fsr_init_valuetrap_pendingcoproc_initcurrent_linenoskip_wdvarnamesetint_verrnoarraynamec_jobstinitforkinitiochange_randomnewenvx_flushstrncasecmpatexitsetegidcur_promptgetintclosedirc_readcleanup_parents_envfindfunctty_statetcopystrncatgetpwnamtokentabmcsetx_readrestore_pipeset_editmodehistlistc_evalc_pwdj_usrtimestrtollocalstrerrordefinebuiltin_optintrcheckmbsetcoproc_getfdclosepipecompilex_emacs_keysinittrapsc_dotshellfreally_exitdb_gthanshprintfstrlcat__asserthashx_getcdb_lthanc_getoptsreset_nonblockshf_fdclosestartlastsetsigarray_ref_lenc_setshf_fdopenrestfdbuiltin_flagstrlcpyx_init_emacsstrncmpsm_sigchldopendiryylextfreelseekcoproc_read_closesetlocaletty_fdstr_nsaveunwindexecvealarmfatal_trappopblockgetppidshell_flags__longdouble_usedc_letpat_scanintrsigset_ttyinit_histvechomedirshistsavehistNmallocmemmovestrlentest_isopedcharssetuidx_longest_prefix__fpstarthist_finishj_killtwalkksh_get_wdx_escapechange_flagqsortsleeptenterc_exechas_globbingtnextapermx_free_wordsainittimexaerrorsigsuspendshf_snprintfpromptlenoptionshf_ungetc_etextnewblockstrchr_PROCEDURE_LINKAGE_TABLE_newlinec_bindshf_readwdcopy_lib_versionj_jobsx_bindcoprocgettrapis_wdvarnamemakenvj_changecheck_fdgetoptionsherepshf_putssourcewaitforheresexpandlibc.so.1SUNW_1.19SUNWprivate_1.1/opt/pkg/liby qN N  Q %y $e(,0428L<C@DHLP]TX\`dhlpdt!x|ChfpWj_*2tVU@In^r  $u(,0x48F<@6DyH0LPT'X \?`[dh lPpmtWx|$$XV5%% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%hjjRthtt PEhu ThRU RPZx+xPRjkURQt`|$у D$td$у`tƒ 3fd$f T$tfd$f L$l$YZ]UEÐUSEtX PÅuEe[ÐUS EP؅t!M CtCe[Ãhj2ːUSVW Et;HpXE PQPt9t~E8t;GE MM Ee_^[Be_^[Ãhj볐US]t0SKtCACM CtKU[[USVWL hh u4tBu?t0Lu3 Puhh Vu  M<= : h`Ẽ hlE72$ 8VP`+$ E 7wEuuă 5$ VMMM@Eȃ RP u5$ Vu uwEPl uȡ$ EPEPRE~h<VGEEu[ ukE5 hdP:EEE EPhEEE؃ hRPEЋ $  EPEPEPVQߧu]܃ S_ $ }}u{ j$ 8tj5$ uE܀8/  EPEPEPVQZ ]]ԃ S $ }c}uÅu" 5  PSh|NVh;Mt PQ7 j$ 8tj5$ uDE܀8/u5 Pܪ؅u]܅t S˩ jSu  h諩]܋E tSh\Mt PQ|3e_^[à hJ h3ʃ h볃 h0뜃 h@녃 htkUSV hh uXtBu?t0Lu3 Puhh V"u  M<5$ >u3(t V4tjV|tVh\'?jj؅t3Sh\t PS3e^[à 5 PhӃ h뼐USVWxu3u+tSh Pb}u6w~$TRMqekeeM_EEL5 >u3E:EPjVE}!MEPjxELSh u蹚]  tEt2  * Mth<Pu  MEE EPhE܋MȉM؋MЋ1U}HF+U؅~RPEP踅H\Fuu \0uduUă3ۃuF]Љ]ȋڃ}wUċ]Ӊ]ȁPFURŨЃwZUȋ]̍PFJSw$Q\Q/ ( !   Q }}FUЃUЋ2t Y2˅Mt @M+uܡ |;Eu M؋}܅EEu1VWu*}= uU+VWu}# S= u+A S]1 @juܡ puu 3e_^[ÃuVh݃uhKPPPPPFP?PVPPP8PPPPPPPP1PPPP*PP#PPPNNNNNNNNNNNNNNNNNNN#NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNfNNN NN6NUSVW,MwE3ۃwtXVh QڕEEtV}?tAVu Epu E vuVh W腕u E M}Uu}t?U܋]}te4DE؅EE Eȃ} E}u! V PVhX uA}u* V PVh t uuVuGHvtVhGw$VVhuPhTL h@|t h4ct hlJu) h(1twh ht&uTPh`}uVhH w 4rtn ht\tot< hu&uTPhSw h@u8}uU h&0t hۉEt# hE؋0E؅hEЍe_^[ÐTT/UT'VUV'VUEEUSVWt0]jSPt}uǍe_^[à h䐐USVWhh 3uIEt`u?tQlu(nu Epu zuEhh V~uQ M4t'3uSP uuSjǍe_^[ÐUSVhu6؀=y tth PV:~?tL M4 tSQuShlu = t 3e^[à hp␐UUE H$t'($rQ2h`uu蠝 %( rQ2hTuuy EÐUSVW3Mq;tp>-ukF ;u ;tJjV;E@;thPP~;u3h(h Q|33ۃt\?tMlu"suj5 ؅4h(h ua|u  M4<O3t MM؅?%tKEPWqE܃|uPuP}uW@  ؃>u5M4]܃SPptdE܍0sE܋E܍H0s$th\uh$u= 1Agfff+؃ }3ME33t P(ȋUR+ыZH#+ЉU vM+H#+؋F t PȋUR+ыZH#+ЉU v$M+H#+؋F@t PȋUR+ыZH#+ЉU vDiM+H#+؋F`t PDȋUR+ыZH#+ЉU vdM+H#+؍-t PȋU+H#+ЉU U+H#+؃jEULQPhkj0hx | $>t6PhK~ tv Sh1~@tv@Sh~`tv`Shƀ0~ h3ۋÍe_^[ÃVhރ5 h{ 5  PWhTTWh99hh Ηh PUS]~3= u3P( P[w, ( e[ÐUSVWh PuFw? EMM؍E܍{s>jV8 @@L{t@M؋UDx3Ƀ?t ǃA8u( ;G=< t t9< #30 uܸ( PWdv؅|+?t8 uE+]E]E?EE( ,  h(]#ȉt jjhjh( 0 tjPWnjW V MjQPC=l t jjjjV ˅ e_^[à h0hTj@ȃVhhh밃 hQ뙃 h:USVWh$h 3utEtEu?t6lu E muh$h V~tub M43uujjj(dt6j=P"t@jSP6ctuʋǍe_^[UE8fÐUSV Xh Pus?tL M4tjEPVU}.9S|u3EEPjV^EhSWqkk E ME8u E u hH  Pu |j?E0؅t' utCSh}t/EЀ EԃPh7EEEЉEE EPhEEE؋E3ۃ8EB33E܉E q@EdF ~HF FHN V譅؅tՃut ~$}t-UB+MA~QREPUE@MEE+E؅~PuEPUE@Etf3 uG= N u访8jj2j5 ?4tjEEHEMW}t\tG tPtK tM+Muu!Exu!EEHEM Exu-E+Et%MI €ttHMuۋE E0E4=l t jjjjE0 juutEE8 V}Eq V|}t4E @ju̡ p,uu>u}u u}u EEe_^[ÃuhE؃uVhEeEZ& V*|E0h|EtUSVh Pug?t] Pj* MF = u   jVfEء PVÍe^[ÐUSVW h Pujf? u<1x{t& hsi3W{(t' hms(hs WV{Ht' h@sHhs@W){ht' hshhs`WÀ;{t* hsIh3hx N}3fjP(t34t >-u~u3t*߃jPt$VPu3e_^[Ã3hhUSVWh Pud? }4t;EPVeYt E  Vhj:8ru$ tv @u!= uZt F S9Ee_^[USVh P3uc? M4t*EPVXt UE t-0v%uJtQfHffHȋ@t0w;UtNt fAffAE E+PQQh,j E8bt P,DEPPhHj3e^[ÃVhXᐐUSVW XExMQjPS}MMDE܋Ct|}u#jWp ؃>uS WȉMƒ u5j[W荶Pu>uÍe_^[ÃAPhِU EPuPhuPhuPhluPhS3ÐUSVWL EPEMytQ3  T Qu EBQEE PR諏E} EP衵3Euu+u5T ]+]  uu]]t t,ruH +EP Phh ~ V Phh ~F +EP Phh ~ Vd Phh ~ S@ PV S`~S?sEe_^[ÐUSV0E EԃjEP^Eh]Su ^t>u:?puFhSu]uʋEE؅tL3~$]ԃ P3E؃F;|ߋMԍUԉ tMԃuEԃ8u E@EԋM e^[ÃuhuhpUSVW u jcd jM@ ;t ʚ; ʚ;ff;|; j؍@@ t ƙ fffkd4 j۲kd@@ tff  uK.Kgfff++k +0A~ͅɉuÍe_^[USV x 33ۋH  ~H  t Vߋ FH  ~H  t V詋 FH  ~H  t Vs FH  ~H  t V= F@ 3e^[à QW  QA ) Q+ I Q iU3Uu ujÐUu ujÐUSVW<3҉UE$E؜EȝEE3;t C8uhQ蹯uKhE4螯kEx}̍EЃ<K23jEPUԃtu4TjjEPU؃EăjEPUԃEEjEPUԃFK}jjEPU؃؀= uhSѮ jjSjEPU܃ thjPEPU؃jPuuEPU܃ Mut }̃ EP# e_^[à hUSVW} t(u>tN~;tEEEC;u(SVɭuEuCHw;uC3e_^[ÐUS4}] $w$EhjPPPut3hPu؋;hȋ;x#ʅ#hPut3dPunȅЋ;E# 'jPu˯jPu謯Cv]Put3hPuȅЋ;E# $(;f;O;8;!; ;Euu1uuEt juuJ}uu˪_EtEMEM Ee[Juu脪Put3?;Puȋ; #Et1QPIuEDž3 PUUPuȃ#$Pu Pu Pu^ 3Pu# MPus Pu Pu` PuS }Pu@ IPu PuPujujusjuV}E8!t PL=| l 0 @P,=} Džl E8E83e[Ð~|nwCۖ?s th7Еؗ-Ǔeeeeeek=T&UME E MSUS] Su褥   uQtIhPu |+|#ȁ@tIu 3 3e[USjuY؋Mu:jQQ uEhjPPEu e[ÐUSV] SuMt3ۋMu)jQQ uSu ] ƍe^[ÐUSV] SuYu3ۋMu3jQQ u!Suȅ#] ƍe^[ÐUMu+jQQ tu uEM M EÐUSVW Mt3jQQ +EjPP Eu VjPP؅EjPP u;Mu VjSjQQ h8jQQ3EVWPPtM VPSWQQ EhTjPP3EhljPP3E] SVPPtM SjPVQQ aEhjPP3Iu ul؋Mt3&jQQ uEhjPP3ۋÍe_^[ÐUS]S;SsSE Hv't42莡3+2PSatMIK } e[UUB;Br} t3 HJÐUSVuE MU]]UME u^[eUS] EH;Ps! tEEM E[nEE E[WUSVW= u9 H S a =tBA:uh h fuJEtX}?tFHuSuau Eh h WHJu <=t# ;΋t?G;u= M42}:~0hxPYu@jEP6藢M܅u w}t&G VP*IEPw֟tutuEPw 辟 t P蠞Ph " h0} =]~tjv Sv}6h\t2N t3ҋ 3ffPhH hPq>lH}{tjs^Ws[3h\t4K t 3ҋ 3ffVhH hP;m]~tjv辝Sv軝}6h\nt2N t3ҋ 3ffPhH6 hP$>l3tjw#*EPwu tEE=t-_ t33fPhH hP3Vhj e_^[à 5 螛Ph  ҃ h  뻃Rhd룃 hUu ujכÐU< 8 4 , ( 0 j!hThϝt  e9 U ÐU=   9 EPhhT5@ l|}fEft? }  jjjjh tMQPf}t- jjjjhll tMQPkÐUS j=p u.=s u%= u(u uu u؃ j]= tÍe[USEjPjJ}S= uJ] t! jj膕jjSjI} = tuEe[ÐU h WU tH   A Eh u_ÐUS] t= tH   A CCh QQ_ uÉ]e[ÐUST E; (  , EM0  4 EM8  < EMp  t EȉM̡x  | EЉMԡ   E؉Mܡ   EM䡐 EEڣ( Eۣ, Eأ4 E٣8 Eܣ< E0 eȿe EEEEEjP5@ 觲 9( u ( 9, u , 94 u 4 98 u 8 9< u < 90 u 0 EjPh( 蒗t* h( b9jhp 5@ Íe[ÐUSVWu3ۋt^3ɀ~ uʋЅtH3Ft:u6 t- t( tt:tC~ K C3ۋuE t8u_^[ÐUSVW uj/VƖtp3ۃ4ŨV#u Crjj4/ue_^[USVWE ];#FP~I}33|.p3; uA{ uA{ uA{ uA;~; ; uACG;~;E }4B}3E܃ u O#E܍_E܈GFE܃ uCC#^]܋؍{E܈CF u _G#F_GF u {C#Fߍ{w| uO#ONJ}E#EHM3ҿsM3Ƀ|vE3t#tCBN u#t CBNF u#tCBFN u#t CBN ȃ;}~;}#t#tCB FG;}~݋E3_^[ÐUSVW,}u EEP ؅}t 3}8jE 0 3} jP ; F;u|;u.~E |/tK~|/u PEE@PE̋UԍLruȅI} }33E3;rN+ẺEЋ PQuE̋E%yH@M+ȋEȋӉ;rN+ẺEЋ PQu蟘E̋E%yH@M+ȋEȋWӉ;u:;ud;rN+ẺEԋ PQu/E̋E%yH@M+ȋEȋӉF;u~;rGŰ+ڋ PQR̗E̸#yH@+؋E j j uđ E ẺEe_^[ j j E Ee_^[{USVWE}3DPu  333t(<\t 3Fu t3F3Bu35  PjX  j=5  Ph'HLHPh Q5 OAH;PrYL+ RPQ L#yIA+ƉHƉPHHH  QL+‹ȃQR蝕3;3G8uuTSQ,uXP6|8u$Vj PS豕3G PS蘕E0+ PS|Vj-E3Ǎe_^[É5 hPj3ڐUM APMAPQu E@M +AUSVWء PV躔 PhȓM؉E܉EEhX QSm Eh PS[ EhH PSI xtu؃GPVS)Lu5 EPSuVhHP腰=tMPQSVE؋]+ËMGhuSU4EԍHMH33҅U]Ћ}3UEw7詋u P7WEЉEFwwntOEЉEF Pw EȃE;Et;ESljEԍx70tEԋEЉEF PE0詒E@E;E~EȋFEԍDE0 PEk P苑EЋMԍQU̅}ЋEEEj6GMt;AuP16蟋tEȉ}EȉG E@E;E~htj uuxE̍p3ҋMЅ}3|.Ẽ13q sqsq$s 0;~;U# B;U~htj QP PuRE;ErLU܋+ڋ PQR藐Eܹ#yIA+ÉEÉEEE؃E؃  QU+‹ȃQR?M#E PS螐3EԋEԍe_^[ÐUSVW ]1;] (~HEÍHA u't"t`t =t:u ~ 9\uIKU ;}HE 0? u.'t)"t$`t=t:t~\u;}~;|}tzHxNU  tJHx0  uEPh@t ;}Mˀ9/tA@;|;3ME+EE3e_^[USV EPuuuu } ؋Ett }t}t 3LEMQSM uQP҃tM$tUMU M E 3e^[USVW u }3 PFPu~3 3t_3\t*tP?tK$tF~(t+Nt((u#Ph8舆u/ Fuu;~ut E *@Íe_^[USVWu3Z E E0豅؍FE܃~:UE2~E3:u FAG;|߃MAM;M~ӋÍe_^[ÐUSVW Mq3ۅ~} х}3҃|LMtPQ OtPQ ;]~;#tPQ踌 C;~݋M E Me_^[鐌USM u u茄Mȋ];tFA;v)/u H;v8/t]H;v /t /u P;s+E3M e[USVWuEPzEP {MM܋} XjuS#to7;wrLO+ RPQ G#yIA+ƉƉG7F PS3 EPbzbe_^[ÐUSVWL u 1@EЋ]E  MQPEEE؅EEE EEEu܃j:S?Eu S輂ÉEE+ÉEF+E؅~PVEPEP;sE;v3|[M<uFFC<uFCFC<uFCFC<uFCF;v;w<uFFC;v/FEE+E؅~PVEP7uuVہU+Z4 jRu.PMAEċ +ȋHM;}#yH@+]ĉ]̋3EԃEPj3w}}t P34M̉ EPM̋ @PEPQ菂EFG;}~i#yH@+]ĉ]̋3EԃEPj3v}}u ẺEF P3gG;}~EčMEX8txuu/e_^[USVW]jhRPyEE E܅EE3<3Ph$UuPu?t:VSUu7jh UjWUE+HE܍\3FE+ƅwM3vM ]͍e_^[a]e_^[USVM  E     35    h  0  EP5  M +ʉ +  ; + 5  +   5 R ;|A  I+ȋh +d ;| +S-   '=q t#t   t   k Ru=0 6t    Ptt't8B00 % + 3e^[à jxjCjUSEt Qt jF΋u   5 ;vN P;5 w ]e_^[U  ;; tz=s uq BPz Py @Pg JB  P- @P+ȃu jm BP @P @P @P JBB H jp3ÐU 3ÐU 3ÐU 3ÐUSVW   +١ += u +H#ƣ 5 5 +y 1P^+ƃjP3e_^[ÐUSh u5 <ء   8 8 th Pp   8   Agfff+k+ʉ  e[U  uA$  4 t   Q h$tj>3ÐUS0 0tuh$ 8 tX P0hء +PjS$ tH 8 t$  Q $  $  h j3e[ÐU      U j3ÐU u       j3ÐU3ÐUSV]u S Ѕt7^t B%C ?|?t B^BC u]e^[ÐUE  t"( ^t@?) *  ( ) ( ÐUSV]t"u: jPh+ jtQh  u VUPhƋ   tk E Ete^[鷍  E Ee^[降USVW  W}t>3k tuQhtKC;r3M] PQE  381t u@ك PulE EE8uN  ƍ8u&  ˋ th Q}l   }3ÉEk tuPcdtC;rÉEk ;G  ƍ<8u&  ϋ th Qk  ƈ }Ƌ yNFθ#È h P\ء  ƍ<8u&  ϋ th Q(k   ljƋ yNFθ È 3WS3}333ۍ  1ttSWP  C  1ttSW,  C  1ttSW  C  1ttSW  CdGR333 0 ttuVW  F 0 ttuVWk  F 0 ttuVWB  F 0 ttuVW  FPG>3e_^[Ãu h ރ hǐUSVW h g h hgغ    +ƒȋ+= ud3@  @  @  @  @    @=~  @=~83CCCCC=~C@=~  Ѝ4  +  += um3@  @  @  @  @    @=~  @=~A  3@@@@@~@C~  A3Ҋqq3AY  q3AY  q3A Y   q 3A Y  q 3AY  q3  Gfh h xe؉ 4 + += uw33<3 މ; މ; މ; މ; މ; =~3 @=~B 330ppp pp~C~ A 3jj_t*hV^];thVI];uq e_^[ÐUSV]U ʋ yIAuE  ^[ÐUS]|jPj j3j~C|j PjgC|jPjPC |jPj9C|j$Pj"e[ÐU  3ÐUSVW = tI +H#4 V+H#+؃j+Sd5  j3e_^[ÐU t   Qf j3USVW E5 =  Eܡ E + H     P[H    S_؋E 5 = Eܣ E  hD ZPr| t S}3e_^[U3ÐUjj3ÐUjj3ÐUjjc3ÐUjjG3ÐUjj+3ÐUjj3ÐUjj3ÐUSVWEPEPEPEP  +Q +PRj9 ؅ EPKjE+EP3~X3 E00Y hPE0|F;}# h#} jFt j03e_^[ÐUSVW,EPEPEPEP  +Q +PRuL u ]+]؃uWEԃt-;)u Mx/ueu}uuWs\ EP jS huԋE0uEEԀx/t h juWY7uuWjguW/ je_^[ÐU   +ы+ H#+Љ   5 錾UEÐU}. tA yu 貽 =~ÐUS] t t 9 |I3 =  = t\@ Stu  t t = t#= | 9 | e[e[ÐUSV]5 tC P7t;5 t]e^[ÐUSE3ۅ|L t=k \|- u Pe   j  3e[USV 5 ؋  +ʉMEP +PR|> E     S~ j  j3e^[ÐUSVh 0= t0 t t "t'uFt t t"t't H  ~dtL t+ t&"t!'tFt0 t t "t'uFt t t"t'tAыȃ ƅt0 t+ t&"t!'tFt t t "t'u P VnSLD;vV t t "t'uI;v: t t"t'tI;v t t"t't  t t "t'uA Q j33e^[ÐUEU#UELUECUSVW   ;I  A %u;  u_t$t C;uLts t WS C;Uuj  u_t&$t QS C;ud t WS C;t=  u _t"$u"t QGS C;uá H   S( j3e_^[USV= uA 3; s+= ~" PC; s;5 |މ   e^[Uu ujQÐUu ujQÐUSV  Pj蟾EF5  j=u4  PVX M M Ee^[LhjvUSVW]; PhVE܉E؍M;r!  QjPVE܉E؉EEEt}؋u VWPuE;ErMM܋+ RPQVEܹ#yIA+ƉEƉEEE؃E؃  QU+‹ȃQR.VÉ]e_^[ÐUS PjUMEEEu QuEU+‹t PR)VÍe[ÐUS Pj#UMEEE] SQu]EU+‹uuSu؃ PuUÍe[USVWEx3fEE];sxt$ Stx% x=| tx=x t x=m txt @xE EPhSMuEƉEELxƒ(tTE3XDž\Dž`DždDžlDžhEP+E@~PVEPMX/$E@EE@E\uUEM} E@EۉX\f}u(EM}EM3}Tu XDž\TIA  Q؋MtHA EPJHMt t uG뷅t uuRQS!MO O L@pL ww$)df|dTpÀ@Ld)\p@Lp@L\tѥt\xt(`tdu ѥtC߃]y$@xa VtFx% l/tlx@{th@hFx h hFLux]tuxtthɀh[u  hFLXuCx(t6tt(u PEPEPLM duu6hF&x h hF3dMF3ThxDžXHx7DžX(x5DžX QMf}t v MxDžX3`DžX3Tt6)Tt   EFu+QPNth@hgxhM h1;qrs Il+pPQljMhApyIAp+‹h‰A1Fh tE @PtPPU p ;Jrh r+ΉlPRVLpAlyIAl+‹p‰A AptIx%Pu t' x Q+uL0QPPu f x(tE EPhKMuEƉETDžlDžh`;u<DžX`DžX`DžX33\3\tDžTp@LMPP \@xpt`P#t %F)FEPq qg P QVPMEpt`P@PDžXDžtxpEP Xuxt`jLCM@L3DžtCp@tDž|jPB@L |QMQPtEP~ XSxt`XjLmXLMDžtxEE Ejp; jPEP\EjLB@L EPetM{DžtDžTu+ DžlDžhtTTDžXT$F(F(Fp tBp+UB~RPEP pL L@Lƅu)@)MpDžtDžT$F(tDV+E@~PVEPVLL@Lu)MFDžtDžTV+MA~QVEP-tVMt@tuDžtDžTCPPu+ Pj|FBPBPfEf+EfBxfBEB\fB MEPt |L#%=?ux xxtw=P@u V>  @tQPE tVPr jPPpdPpbMEpt`P@PDžXDžtx xFM3\DžtEux(x xtU?tBP@P3XDžt*U;t3TLBM;t SD= @PSS4xESP@Ph*bxEe_^[ÃhjzcvjL:Stphj@j!Mt xMPha;;Jv;pG38{iUSVW8EMȉME}u3 PSEuPEP1uu8E +H+ƍe^[ÐUSVW\uE ,};_v/C/u/S+A~QSWSFڃ/tуj/V0tG V+0<DžWVqE@+ȉuP P1 P1ȅEЃ ƒE Ey y .u >.jVWv WR/@É+~PSQWS/H Q X 0ȅ$ 0`M++G~WSQ؋E+PVS_SZ.ËM  uuQul A }u?`TPEpI3PEpH;{/t3w%=@=FXPQ+l%=@tutmEH;vc{/t]%=@tD=uDu#XPQ|~l%=@u/CE8;xrXH+ RPQ3A#yIA+NjljA9GEH P+SQ$ue_^[USVWju [,E +ȉM};QPu+]]Etc;s_uFFt:QhH+t t C+E;s(C+E C+EFt;rME ;tuPQ,Ee_^[ÐUSVW,uEE EPj1E܋MȉM؀>}u<N/trx+UB~RPEPxNǀ>t?N/t6:t1x+UB~RPEPxNǀ>tvtuu23t uwuu1tR?tFE EԍKUԋ+@~PSR;؍K<u QًʈGـ?uEuǍe_^[ÐUMtZ+t&-u'yu! h8LJPMHyt QG4 h4JPM h@JPM=u3ÐUSVW u Puh um u*؅t^ s(Cv+|8/t$_h SP誾F 8/^ h P>F F 3e_^[ÐUSVWLEEEȃMM M܋UU%EԋE+EЃju(~{tjVi(tq~{uV3tXt<uF{t5}t-Fu7<uF{t}t,uFuKCFtu΅B:uu:Y];E+ƉE̋E E+ȉMЋEEM̉MԋEEEӍB؀:J{}tZ,}MIM؍Z+EȍHMEЉEẺE  QP- uuW&EljEuuP& uVE܍DP&ED uEEPuWu ]E؍Z;}u{E؋;XrRH+ً RPQ\-M؉A#yIA+ËM؉ÉACM؉uЋEPPEԉEE؉E E܉Ee_^[8EEe_^[Uu uj[&ÐUjju'ÐUSVW\3uE; E t6E u,Et!E j%PuXE j t j!E3ۃ5 E@ ME@ PqEE tEPup= E hEPHjP Ph WE8t@3MȃytQE0hWgFE<uǃ h 5E3ۅtEj0؁e Ex uEt Eu6 Pj@z*  A j@j p %Ex t[Ep >tPS6@| >u4EE b{XKE7$(%E@UE#cEMuqp$ WuuE PumEEupSEME %PqE}EjpZ؋E@EETEEE@EEt6Ej 0tjPSu1EEuʋE@EEEtME %PqEExEhptME %PApME %PApEL fj P0#؅t3 @t uEEEhp.M :ME %PqEEhpM :tpEExtEj p @@E fj P"؅t3 @t uEEE tduu ؅tA3EE p@ jSPfEME %PqEEkE^EEE p? jSPEME %PqvEEu EEMIME@E؜AEAE B PyEEhp t3EEhpEExt:EM :u"ME %PqECM 7ME PqtEEPh j  fj P؅= t = [ jIjjIF  I fjj.F  I fA EPFE E   }C EPFE jjuEE   jjP]EEjPj fe ME 5  Pq4PEu.ME %PqE@EEtҋE %PuEWM e jjD  I fjj @ PDjjD  I fAEuk] SZE jju?DME u Pq:O jjuDSnEM E@EEt @ @PjD3ۡ @ fXE j@PuNM ;uAM ;u7E2ME PqrEu uSucEE E Et$E u=r  j1JEEuEe_^[à hX? Po PShd@?蛧 S荧 S hl?jjPBuEjPj7? S蚥 j营 j膥'$$#"x"  ]  pp'$ lO!USVW<3EԀ=u tEE8t=Xxt;u jhjhh`EjsP?M EM y E x E x <E x WEMj3V h@Vupu}h@VWptEEt= =EС MU3ۃ<u#EHxEMMEЃPE00 E 2EE8tej W E E E1E tIE x: 3,h(j<EE Et)E8tE tE t3EEC4t+E t$E xuE u3ɉME@EE=l tMuF3ۃ8EEȃj <F0È= u7 h77P:jP Phh FǃxtPuhh ~u h b jjjuuB }t}u jjjh@uvB CF< ]3 E uL= t1j/VtVhj:EuVE E @uSu EE uZE xfE jjjp Vx jPV@E  E؋M u  @XC3ɅtEAEEuI @HE t\ @H  P(  , B(J,0  4 B0J48  < B8J<@ B@ jF E܋E u3 E %EM E  fj P؅u$M E%Pq 2 Eأ Eܢ M E % EE %=u9E t$M E E M qp u-E w"$$.t SϞ EjYShdjY9ME pVhpj68E+E xVhj 8Et E u,E xgVh<j7E jhjhh`> M jq P*8Et9AEt =y t!jh@jh`f E E @   juh `EE EԋEEԉEEe_^[ÃWhDg6 5 yM PqVhj6 E럋E pEPVhj|6E~qE pPVhLjN6E~CEԣ  j艜+++++++++USV h0?1P4t#8tjj5 P2؅t;uuNAFFFFu P0\5 >PSvh$ 5USV u6o P6hH ؅tVSHe^[Ã6hj)6USVW3ɡ p3;tv}tN]} FEWSPuRvLtuEWSuH@ "}] SWFP`uvLue_^[ÐUSVW uy jPu?tD]F  S5 jPS utvv (] t0vs"F ȃKt 3 Ve_^[ÐUSVu3=t*t +u FՃ VW PVhH |@M H ue^[ÐUSVW} uE j/u t3 u 3E3?uuhH lE3t3t3t -tsjuuDtZ h -P1=tNQjPuFFFtMt t t Etu{ǃE uuh atit<jv B t(th v ~(uQ}t t   uuh 1F u @ NMQjPu؅t; t+h SҠF  PS^ XtP h +P//=t0ujPut       } ƍe_^[USVh uVTVc؅}uKt.K 9/t&th s  V؅uAt&th s  V؅ue^[ÐUShPu}p] Su }  @uM|#сt@uIu tUt:u e[ÐUSVWu3;u]E+SPuua3e_^[USVW ] $ u x Wjj jh ~SV Wx3  $ Íe_^[ÐUSVWu^F0tT= u3PSs؋N8B}t+E vjQAj Q1 3ÐUSVuE MU]]UME u^[9OUEu uhj#U(EEEuuPMU ÐUS4E؉EԋE E܉E3EE j5j Pn؅t.Et s E3 ud]ԃ{(uC'L Cj SPur Mԃy(u[] u P uPS! PS$Ԉe[à h\ SjjQUSE w$DuE0hj uE0hjc uE0hjG uE0hj+ uE0h<j g]C&uKB'u s+(ud)uCMEE k pQ3hPj j FD-DDCCCUSVW,E EMYC߃#tSv Cڃyq Q0 Qj}wSW-W Qj uTEx$ P QjuPuv QjuPu6 QfjuPu!t"t u^ ~ F V EHFjVQP)u'HEЃPuT}_Ck x;E Wu܃u CE؃ w+GVWCE؃ v-tPtKtFuWPWE(uSWj WPWqEԍCvCwEԃx u rE@  $JEԋ@ EEԋ@ E~ tG uW-PWEԃ~ tG HG E_x EM~ uG uWPWEԃ~ tEԃx E G HG EF M A EF M3A EF M#A EEԋ@ 9F EEԋ@ 9F EEԋ@ 9F EEԋ@ 9F EkEԋ@ 9F ETEԋ@ 9F E=F MԋI E*F MԋI EF M+A EF MA EF EMԋI x;EEUF MԋQ U@@ tMEfMfEF MA E~ t?j W% WG j WEO :G j WO % WHj Wuԃ} v t@EF 8MԋEA U܋uuu7 QRuԋ_Cwk x;Eƍe_^[ÃjjQhjPhjWhjW+J+J{HdHGI_I6I%IIIHSHBH1HIHHHHHGGI_I6I%IISHBH1HIrGUSVWEp tF uEEpօ  F u[u V/r]{ uBK P+PQÈW|C PWxCC&uZp3+E;uwWVt EuۋE@)MEAk t_t F_t u#tN P+PRa}G G@GX GPP(tE PSoG'@(Epe_^[Ãhju0SjW$